KEGG   Arabidopsis thaliana (thale cress): AT5G17310Help
Entry
AT5G17310         CDS       T00041                                 

Gene name
UGP2
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
Module
ath_M00361  Nucleotide sugar biosynthesis, eukaryotes
ath_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT5G17310 (UGP2)
   00052 Galactose metabolism
    AT5G17310 (UGP2)
   00500 Starch and sucrose metabolism
    AT5G17310 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    AT5G17310 (UGP2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AT5G17310 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 831596
NCBI-ProteinID: NP_197233
MIPS: AT5G17310.1
TAIR: AT5G17310
Araport: AT5G17310
UniProt: P57751 A0A178UCA6
Position
5
AA seq 470 aa AA seqDB search
MAATATEKLPQLKSAVDGLTEMSENEKSGFINLVSRYLSGEAQHIEWSKIQTPTDEIVVP
YDKMANVSEDASETKYLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIE
NLNNKYNCKVPLVLMNSFNTHDDTQKIVEKYTKSNVDIHTFNQSKYPRVVADEFVPWPSK
GKTDKDGWYPPGHGDVFPSLMNSGKLDAFLSQGKEYVFIANSDNLGAIVDLKILKHLIQN
KNEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWV
NLKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPV
KATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVEL
DSLKVSGDVWFGSGVVLKGKVTVKANAGTKLEIPDNAVLENKDINGPEDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaccgcaaccgagaagctccctcagctcaaatccgccgtcgatggacttact
gagatgagcgagaatgagaagagtggattcatcaacctcgtttcacgttacctcagtggt
gaagcccagcacattgaatggagcaagatccagacacctactgatgaaattgttgttcct
tatgataaaatggctaacgtctctgaagatgcttccgagaccaaatatctgttggacaag
cttgttgtgctgaagcttaatggaggtttgggaaccacaatgggatgcactggtccaaaa
tcggttattgaagttcgtgatggtttgacatttcttgacctgattgttatccagattgag
aatctcaacaacaagtataactgcaaggttcctttggttcttatgaactcattcaataca
catgatgacacacaaaagattgtggaaaaatacaccaagtcaaatgttgatattcacact
tttaatcagagcaagtatcctcgtgttgttgctgatgagtttgtgccgtggccaagcaaa
ggaaagactgacaaggatggatggtatcctcccggtcacggtgatgtattcccatctctc
atgaacagtggcaagcttgatgcgttcttatcacagggtaaggagtatgtgttcatcgcc
aactcagacaacttgggcgcaatcgttgacttaaaaatcttgaagcacctgatccagaac
aaaaatgagtactgtatggaggttacacccaaaacactagctgatgtaaagggaggaact
ctcatttcttacgaaggaaaagtacagcttttggagattgctcaggttcctgatgaacat
gtaaatgaattcaaatcaattgagaaattcaagattttcaacaccaacaacctatgggtg
aacttgaaagccatcaaaaagcttgtggaagctgatgcacttaaaatggagatcatccca
aacccgaaggaagttgacggagtcaaagttcttcagctggaaactgcagctggtgctgcg
ataaggttttttgataatgcaattggtgtgaatgtacctcggtcacggttcttgccagtg
aaggcaacttcagacttgcttcttgttcaatcggatctgtacacactcgtagatggcttt
gtcacaagaaacaaagctagaacaaaccccacaaacccagcgatcgagttgggacccgaa
ttcaaaaaggtagcgagtttccttagccggttcaagtccatcccgagtatagttgagctc
gatagtcttaaggtctcaggtgatgtttggtttggctccggcgttgttctcaagggcaaa
gtgacagtaaaggcaaacgccgggactaaacttgaaatccctgacaatgccgtgctcgag
aataaggacatcaacggtccagaggatctgtga

DBGET integrated database retrieval system