KEGG   Arabidopsis thaliana (thale cress): AT5G18110Help
Entry
AT5G18110         CDS       T00041                                 

Gene name
NCBP
Definition
(RefSeq) Putative cap-binding protein
  KO
K03259  translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03013  RNA transport
Module
ath_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G18110 (NCBP)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT5G18110 (NCBP)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT5G18110 (NCBP)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT5G18110 (NCBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 831929
NCBI-ProteinID: NP_197312
MIPS: AT5G18110.1
TAIR: AT5G18110
Araport: AT5G18110
UniProt: Q9FK59
Position
5
AA seq 221 aa AA seqDB search
MEVLDRRDDEIRDSGNMDSIKSHYVTDSVSEERRSRELKDGDHPLRYKFSIWYTRRTPGV
RNQSYEDNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGG
KWIIRFSKVVSARFWEDLLLALVGDQLDDADNICGAVLSVRFNEDIISVWNRNASDHQAV
MGLRDSIKRHLKLPHAYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaggttttggataggagagacgatgagatcagggactcgggaaacatggacagcatc
aagtcacactatgttaccgactctgtttccgaggaacgccgctctcgtgagctcaaggat
ggagaccatcctttacggtacaagttttcgatatggtacactcgtcgcacaccaggggtt
cggaaccagtcttatgaagataacatcaagaagatggtagaattcagcacggttgaagga
ttttgggcctgctactgtcaccttgctcgttcttctctcttgcctagtccaacagatctt
catttctttaaggatgggattcgtccattgtgggaggatggtgccaactgcaatggagga
aagtggatcatacgtttctcaaaagttgtatctgctcgcttctgggaggatctgcttctt
gcgttggtaggcgaccagcttgatgatgctgataacatatgtggggcagtactgagtgtc
cgtttcaacgaggacatcattagtgtatggaatcgcaatgcttctgaccatcaggcagtg
atgggtttgagagactcaatcaagcggcatttgaagttgcctcatgcatatgtcatggaa
tacaagccacacgatgcttctctccgcgacaactcttcctacagaaacacatggctgaga
ggatag

DBGET integrated database retrieval system