KEGG   Arabidopsis thaliana (thale cress): AT5G18240Help
Entry
AT5G18240         CDS       T00041                                 

Gene name
MYR1
Definition
(RefSeq) myb-related protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_CC_LHEQLE Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 831942
NCBI-ProteinID: NP_197325
MIPS: AT5G18240.1
TAIR: AT5G18240
Araport: AT5G18240
UniProt: Q9FK47
Position
5
AA seq 402 aa AA seqDB search
MYYHNQHQGKSILSSSRMPISSERHPFLRGNGTGDSGLILSTDAKPRLKWTPDLHERFVE
AVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV
EENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEAQGK
YLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHHQQM
QKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRMELTW
AEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTEERF
NENNEDCKLETHTRTALDLNTHDENYGTTRPKQFDLNGFSWN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtattaccacaaccagcaccaaggaaagagcatcctctcttcatcgagaatgcccatt
tcttctgaaaggcatccgttcctcagaggaaatggcacaggagattctggactcattctc
tccactgatgcaaagccacgactaaaatggactccagatcttcacgagagatttgttgaa
gcggtcaaccagcttggaggaggagataaggctactcctaagacaatcatgaaagtcatg
ggcattccaggccttaccttataccatctcaagagtcatcttcagaaatataggctaagc
aagaatcttaatggacaagctaacagcagtttaaacaagacaagtgtgatgaccatggta
gaagaaaacccccctgaagtagacgaaagtcacagtgagagtttaagcattggaccacag
ccgagcatgaacttacccataagtgatgcccttcaaatgcaaatagaggtccagagacgg
ctacacgagcaacttgaggtacagcgacatttgcagctcaggatagaggctcaaggaaag
tacctgcaatcgattctggagaaagcacaagagactcttggaagacagaacctaggtgca
gctgggattgaagcaacaaaagctcaactctcagaattagtatctaaagtatcagcagac
tatccagactctagtttcctcgaaccgaaagaactgcagaatctacaccatcaacagatg
caaaaaacgtatccacctaactcctccctggacagttgcctaacctcaagtgaaggaact
cagaaagccccaaagatgcttgacaacagactgggattaagaacatatattggagattca
acttcagagcagaaagagataatggaagagccattcttccatagaatggagctcacatgg
gcagaagaagaaagcctcagagagaatcacaacaggccatatctttcaacaatggttaac
aacgcagaaccgagaatctcgtcttcaagaagaagtcctggaagattgtcaataggagtg
ggattacatgaacacagaggaaggagtagcaacaacagtgagtatacagaagaaagattc
aacgagaataatgaagattgcaagcttgaaacacacacaagaacagctctagatcttaac
acacacgacgaaaactatggcacaacgcgtcctaaacagtttgatttaaatggtttcagc
tggaattga

DBGET integrated database retrieval system