KEGG   Arabidopsis thaliana (thale cress): AT5G19020Help
Entry
AT5G19020         CDS       T00041                                 

Gene name
MEF18
Definition
(RefSeq) mitochondrial editing factor 18
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 PPR_long ATP13
Motif
Other DBs
NCBI-GeneID: 832021
NCBI-ProteinID: NP_197403
MIPS: AT5G19020.1
TAIR: AT5G19020
Araport: AT5G19020
UniProt: P0C8Q8 A0A178UD64
Position
5
AA seq 685 aa AA seqDB search
MIKLIRFFRSRRCWVISLQARCFSAPSRTHFDFSGESSDTERALVSALGSCASSNDVTCG
RQIHCRVLKSGLDSNGYICNSVLNMYAKCRLLADAESVFRDHAKLDSASFNIMVDGYVRS
RRLWDALKLFDVMPERSCVSYTTLIKGYAQNNQWSEAMELFREMRNLGIMLNEVTLATVI
SACSHLGGIWDCRMLQSLAIKLKLEGRVFVSTNLLHMYCLCLCLKDARKLFDEMPERNLV
TWNVMLNGYSKAGLIEQAEELFDQITEKDIVSWGTMIDGCLRKNQLDEALVYYTEMLRCG
MKPSEVMMVDLLSASARSVGSSKGLQLHGTIVKRGFDCYDFLQATIIHFYAVSNDIKLAL
QQFEASVKDHIASRNALIAGFVKNGMVEQAREVFDQTHDKDIFSWNAMISGYAQSLSPQL
ALHLFREMISSSQVKPDAITMVSVFSAISSLGSLEEGKRAHDYLNFSTIPPNDNLTAAII
DMYAKCGSIETALNIFHQTKNISSSTISPWNAIICGSATHGHAKLALDLYSDLQSLPIKP
NSITFVGVLSACCHAGLVELGKTYFESMKSDHGIEPDIKHYGCMVDLLGKAGRLEEAKEM
IKKMPVKADVMIWGMLLSASRTHGNVEIAELAATELAAIDPSHGGCKVMLSNVYADAGRW
EDVALVREEMRTRDVEWSRAFSGVV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaattgattcgttttttccggtctcggcgctgttgggtcatttctctgcaggcg
agatgcttctctgctccgagtcggacccacttcgatttctccggcgaaagctccgatact
gaacgagctctcgtctctgctcttggatcgtgcgcttccagtaatgacgtcacttgtggt
agacagattcattgccgtgtcttgaaatccggtcttgattctaatggatacatatgtaat
agcgttcttaacatgtacgctaaatgccgtctcttggctgatgcggaatctgttttcagg
gatcacgcgaagcttgattctgcttcgttcaatattatggttgatgggtatgttagatct
cgtagactttgggatgcgcttaagttgttcgacgtaatgcctgagagaagctgtgtctcg
tatactactttgataaagggttatgctcaaaacaatcagtggagtgaagctatggagctt
tttagggagatgagaaatttgggaattatgctaaatgaagttactttagccactgttata
tctgcttgctcacatttgggtgggatttgggattgtaggatgttgcagagtttggctatt
aaactcaagcttgaaggtcgtgtttttgtttcgacgaatttgctgcatatgtactgtctt
tgtttgtgtttgaaggatgctcggaagttgtttgatgaaatgcctgagagaaatttagtt
acttggaacgtgatgttaaatgggtactcaaaagctggacttattgaacaggctgaggaa
ttgtttgatcagattactgagaaagatattgtctcgtggggtacaatgattgatgggtgt
ctccgaaagaatcagcttgacgaagctcttgtttactacaccgagatgctgcgctgtgga
atgaagcctagtgaagttatgatggtggaccttctctcggcttcagctcgatcagttggt
agctccaagggtttgcaacttcatggtaccattgtgaaaaggggttttgattgttatgat
ttcttacaagcaacgatcatacatttctacgctgtctctaatgacataaaactcgctctt
cagcagtttgaagcgagtgttaaggaccacattgcgtcgagaaacgcgttgattgcagga
tttgtgaagaatggaatggttgagcaggcaagagaagtatttgatcagactcatgataaa
gacatcttttcatggaacgctatgatatcgggttacgcgcaaagtctatcgcctcagtta
gctctacatctattccgcgaaatgatcagtagtagccaagtaaaaccagatgcaatcaca
atggttagtgttttttctgcaatttcttctctaggatcgttggaagaagggaagagagca
catgattatctaaactttagcacgattcctcccaacgacaatctaaccgctgctataatc
gacatgtacgccaaatgtggaagcatcgaaactgctctaaacattttccaccaaacaaag
aacatttcttcttctacaatctctccctggaacgccatcatttgcggctcagcgacacat
ggccatgcaaaactagcgcttgatctctactccgatctccaatctctccccatcaaaccg
aacagcatcacttttgtcggtgtcttgagcgcatgctgccatgcagggctagtggagtta
ggtaaaacgtatttcgaaagcatgaagagcgatcacgggatcgagccagacatcaaacat
tatggatgtatggttgatttattggggaaagctgggagattagaggaagctaaagaaatg
atcaagaagatgcctgtaaaggctgatgtaatgatctgggggatgttattatcagcttca
cgaactcacgggaacgtcgagatcgccgaacttgcggctactgagctagcagcgattgat
ccatctcatggaggatgcaaagttatgctttcgaacgtttatgcagacgcagggagatgg
gaagatgtagctttggttagagaagagatgcgaacgagagatgttgagtggtcacgtgcc
ttcagtggtgttgtgtga

DBGET integrated database retrieval system