KEGG   Arabidopsis thaliana (thale cress): AT5G19180Help
Entry
AT5G19180         CDS       T00041                                 

Gene name
ECR1
Definition
(RefSeq) E1 C-terminal related 1
  KO
K10686  ubiquitin-activating enzyme E1 C [EC:6.2.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT5G19180 (ECR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT5G19180 (ECR1)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     AT5G19180 (ECR1)
Ubiquitin system [BR:ath04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   AT5G19180 (ECR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ThiF E2_bind
Motif
Other DBs
NCBI-GeneID: 832038
NCBI-ProteinID: NP_568370
MIPS: AT5G19180.1
TAIR: AT5G19180
Araport: AT5G19180
UniProt: O65041
Position
5
AA seq 454 aa AA seqDB search
MADLDVPPQVPQSKTRDLDKLLLRHGNLVDPGFVPGPGLRDDIRDYVRILVIGAGGLGCE
LLKDLALSGFRNLEVIDMDRIEVTNLNRQFLFRIEDVGKPKAEVAAKRVMERVSGVEIVP
HFSRIEDKEIEFYNDFNIIALGLDSIEARKYINGVACGFLEYNEDDTPKRETIKPMVDGG
TEGFKGHARVILPGVTPCFECTIYLFPPQVKFPLCTLAETPRNAAHCIEYAHLIQWETVH
RGKTFDPDEPEHMKWVYDEAIRRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACA
LETLKIVSACSKTLVNYLTYNGGEGLYTEVTKFERDTECLVCGPGILIELDTSVTLSKFI
EMLEDHPKLLLSKASVKQGENTLYMQAPPVLEEFHRPKLSKPLYDLMGRVQKDTIHVFGQ
RALKNNEKESCTTKVRVVFKGADGVADMDTAIGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcgatgttcctcctcaagttcctcaaagtaaaactagagaccttgacaag
cttcttctccgtcatgggaatctcgttgaccccggcttcgtacccggacccggcctgagg
gatgacataagggattatgtgagaatcttggtgattggtgcgggtgggttgggttgtgag
cttctcaaggatttagctctttctggttttcgtaatctcgaagtgattgatatggaccgt
attgaggttactaatctcaatcgccagttcctgttcaggattgaagatgtaggaaagcct
aaggcagaggtagcagcaaagcgtgtaatggagagagtgagtggagtagagattgtgccg
catttttcacgtatagaagacaaagagattgagttttataacgattttaatatcattgct
cttggtcttgattctatcgaagctcgcaaatacatcaatggggtagcttgtgggtttctt
gagtataatgaagatgatactccgaaaagagaaacgatcaagccaatggtagatggggga
actgaaggtttcaagggtcatgctagagttatcttgcctggagttacaccctgttttgag
tgcactatttatcttttcccacctcaagtgaagtttccgttgtgcactcttgcagaaacc
cctaggaatgcagctcattgcattgaatatgctcatcttattcagtgggaaacggttcat
cgtgggaaaacctttgatcctgatgaaccagaacatatgaagtgggtttatgatgaggct
atcaggagagctgagctttttggaattccaggtgtcacatactctctcacacaaggtgtg
gttaaaaacataataccggcgattgcttccaccaatgcgataatatctgcagcttgtgca
cttgaaaccttgaagattgtgtctgcatgcagcaaaacacttgtaaattatttgacgtat
aacggtggagagggtctttacactgaagtgacaaagttcgagagggacaccgaatgtctt
gtatgtggtccgggcattctgattgagctggacacctcagtcactttatcaaagttcatt
gagatgcttgaagatcacccgaagcttctattgtcaaaagcaagtgttaaacagggggaa
aacactctctacatgcaggcacctccggttctagaagagtttcacagaccaaagctaagc
aagccgctttatgacctcatgggaagagtccagaaggacactatccacgtgtttggacaa
agagccctcaagaacaatgagaaagagtcgtgcacaacgaaggtaagagttgtattcaaa
ggagccgatggtgttgcagacatggatacagccattggagcatga

DBGET integrated database retrieval system