KEGG   Arabidopsis thaliana (thale cress): AT5G20510
Entry
AT5G20510         CDS       T00041                                 

Gene name
AL5
Definition
(RefSeq) alfin-like 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Alfin PHD Pox_Ag35 DUF4746 C1_2 zf-RING_2 Zip
Other DBs
NCBI-GeneID: 832173
NCBI-ProteinID: NP_197551
MIPS: AT5G20510.1
TAIR: AT5G20510
UniProt: Q5XEM9 A0A178UN04
Position
5
AA seq 260 aa
MEGGTAHYSPRTVEEVFRDFKGRRAGIIQALTTDVEDFFQQCDPEKQNLCLYGFPNEVWE
VNLPAEEVPPELPEPALGINFARDGMQERNWLSLVAVHSDAWLLSVSFYFGSRFGFDRAD
RKRLFSMINEVPTVYEVVTGNAEKQTKEMPSSANQNGNRSKSNSKMRGLESKSSKTIHAK
DEEEGLELEEGEEEEDEDEDEHGETLCGACGDNYASDEFWICCDMCEKWFHGECVKITPA
RAEHIKHYKCPTCSNKRARP
NT seq 783 nt   +upstreamnt  +downstreamnt
atggaaggaggaactgcgcactacagccctcgaactgtcgaagaagtctttcgagatttt
aagggccgtcgagctggcatcatccaagctctcaccactgatgtggaagattttttccag
caatgcgaccctgagaagcagaatctctgcttgtatggattcccaaatgaagtgtgggaa
gttaacttaccagctgaagaagtgcctcctgagcttcccgaacctgcactcggcattaac
tttgccagagatgggatgcaggaaagaaactggctttctctcgttgctgtccacagtgat
gcgtggttactttctgtgtctttttactttggttcaagatttggtttcgatagagctgac
aggaagcgcttgtttagtatgataaatgaggttcctactgtatatgaagttgtaactgga
aatgcagagaagcaaacaaaggaaatgccctcttcagcaaatcaaaatggcaacagatcc
aagtcaaattcaaaaatgagaggtttagaaagtaaaagttcaaagacgatacatgccaag
gatgaggaagaaggattagagttagaagaaggggaagaggaagaggatgaggatgaagac
gaacacggtgaaaccctatgtggagcatgtggagataactatgcttctgatgaattctgg
atttgctgtgacatgtgcgagaaatggttccacggggagtgtgtgaagatcactccagct
agagcggagcatatcaagcattacaagtgccctacttgcagcaacaaaagagcacgaccc
tag

DBGET integrated database retrieval system