KEGG   Arabidopsis thaliana (thale cress): AT5G20980Help
Entry
AT5G20980         CDS       T00041                                 

Gene name
MS3
Definition
(RefSeq) methionine synthase 3
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00450  Selenocompound metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT5G20980 (MS3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AT5G20980 (MS3)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     AT5G20980 (MS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1 LCD1
Motif
Other DBs
NCBI-GeneID: 832223
NCBI-ProteinID: NP_001078611
MIPS: AT5G20980.1
TAIR: AT5G20980
Araport: AT5G20980
UniProt: Q0WNZ5
Position
5
AA seq 812 aa AA seqDB search
MGQLALQRLQPLASLPRRPPSLPPPSSATPSLPCATASRRPRFYVARAMSSHIVGYPRIG
PKRELKFALESFWDGKTNVDDLQNVAANLRKSIWKHMAHAGIKYIPSNTFSYYDQMLDTT
AMLGAVPSRYGWESGEIGFDVYFSMARGNASAHAMEMTKWFDTNYHYIVPELGPDVNFSY
ASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSLIDKILPVYKEVL
ADLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSHMESSLAGLNVLIATYFADVPAEAY
KTLMSLKCVTGFGFDLVRGLETLDLIKMNFPRGKLLFAGVVDGRNIWANDLSASLKTLQT
LEDIVGKEKVVVSTSCSLLHTAVDLVNEMKLDKELKSWLAFAAQKVVEVNALAKSFSGAK
DEALFSSNSMRQASRRSSPRVTNAAVQQDVDAVKKSDHHRSTEVSVRLQAQQKKLNLPAL
PTTTIGSFPQTTDLRRIRREFKAKKISEVDYVQTIKEEYEKVIKLQEELGIDVLVHGEAE
RNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDITRPKAMTVFWSSMAQKMTQR
PMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGVTVIQIDEAALREG
LPLRKSEQKFYLDWAVHAFRITNSGVQDSTQIHTHMCYSNFNDIIHSIIDMDADVITIEN
SRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSTEEIAERINKMLAVLDSKVLWVNPD
CGLKTRNYSEVKSALSNMVAAAKLIRSQLNKS
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagctcgctcttcagagactccagccgttagcttcgcttccaagacgccctcct
tctctcccgccaccgtcttcagctactccgtccctcccttgcgcaaccgcctctcgccgc
ccccgattctacgtcgccagagcaatgtcatcccacatcgttgggtatcctcgtattgga
ccgaagagagagcttaagtttgcattggagtccttctgggatgggaaaaccaatgttgat
gatttgcaaaatgttgctgctaatctgagaaaatcgatttggaaacatatggctcatgct
ggaatcaaatatattcccagcaatactttttcatactatgatcagatgttggataccaca
gcgatgcttggtgctgttccctctagatatggttgggaaagtggtgagattgggtttgat
gtttacttctccatggcacggggaaatgcttctgctcatgctatggaaatgaccaagtgg
tttgataccaactaccattacattgttcctgagttgggtcctgacgtcaatttctcctat
gcatctcacaaggctgtggttgaatttaaggaggcgaaagcacttggcatagacacagtt
cctgtgctcattggtcccatgacctacttgctcctgtcaaaaccagcaaagggtgttgaa
aaatcattctgccttctttctctgattgacaagattcttcctgtctacaaagaagttttg
gctgatctcaagtctgctggtgcacgatggattcagttcgatgagcctatacttgtgatg
gatcttgacaccagccaattgcaggcattttccgatgcgtactctcacatggagtcatct
ttggcaggcttgaatgttcttattgccacatactttgcagatgttcctgctgaagcgtac
aagacattgatgtctttgaaatgtgttactgggtttggatttgacctcgttcgtggattg
gagactcttgatttaatcaagatgaattttcctcgtgggaagctactatttgctggagtt
gttgatggaaggaacatttgggcgaatgatctttctgcgtcactcaagacactacagact
cttgaagacattgttggaaaagaaaaagttgtggtttctacttcttgctctctactccat
actgctgtggacttagtgaatgaaatgaaacttgataaagaactaaaatcttggcttgca
tttgctgcacaaaaggtcgttgaagtgaatgcacttgccaaatcattctctggagctaag
gatgaggcattgttttcttctaattccatgcgtcaagcttctagaagatcatcgccaagg
gtgacaaatgcagctgtacagcaggatgttgatgcagtaaagaaatctgatcaccaccgt
tcaacagaagtaagtgttaggctacaagcccagcagaagaagcttaaccttcctgctctt
ccaacaactacaattggatcttttcctcagaccacagatctcagacggatacgcagggaa
ttcaaggccaaaaagatatcagaagttgactatgtccagactatcaaagaggaatatgaa
aaggtaatcaagcttcaggaagaacttgggattgatgtattggtgcatggggaggcagag
agaaacgatatggtggagtttttcggtgagcagctgtctggctttgctttcacttcgaat
gggtgggtccagtcatatgggtcccgctgtgtcaagccacctatcatctatggtgatatc
acccggccaaaggcaatgacggttttctggtcgtcaatggcacagaaaatgacccaacgt
cctatgaaggggatgctcacaggccctgttacaattctcaattggtcctttgttagaaat
gaccaacccaggcatgagacatgtttccaaattgcacttgccatcaaagatgaggttgag
gaccttgaaaaggctggtgtcactgttatccagattgatgaagctgcattaagagaggga
ttgcctctcagaaaatccgagcaaaagttttaccttgactgggccgtccacgcattcaga
attacaaacagcggtgtgcaagacagtactcagatccacacccacatgtgctactcaaat
ttcaacgacatcatccactcaattattgatatggatgctgatgtgatcactattgagaac
tcacggtcagatgagaagctcttatcagtcttccatgaaggagtgaaatacggtgctgga
attggtccaggggtttatgacattcactctcctcgtatcccatctactgaagaaatagct
gaacgtatcaacaagatgcttgctgttctggacagcaaagtcctttgggtgaaccctgac
tgtggcctaaagacgcggaattactctgaagttaaatctgcacttagcaacatggttgca
gctgccaagctaatccgctctcagctaaataagtcatga

DBGET integrated database retrieval system