KEGG   Arabidopsis thaliana (thale cress): AT5G22030Help
Entry
AT5G22030         CDS       T00041                                 

Gene name
UBP8
Definition
(RefSeq) ubiquitin-specific protease 8
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP
Motif
Other DBs
NCBI-GeneID: 832263
NCBI-ProteinID: NP_001318617
MIPS: AT5G22030.1
TAIR: AT5G22030
Araport: AT5G22030
UniProt: Q9C585 A0A178UPQ0
Position
5
AA seq 871 aa AA seqDB search
MNGTSPDESPDSTTQRIDSFNGEQRVYFVPLRWWKDAQDSMPSESVEKREILYTASCGSS
YGGPMKLINNIFNSDILFDLRREGDALQNGETGEASVSGRDFALVSSDMWLQALKWYHDD
KNTEKGVKSFSAGGVDRGDVYPVQLRLSVLQETNSLAVKICKKDNSVECFRRACKIFSLD
SEQLRIWDISGQTTLFFESDVSNSKDCQQQADQEILLELQIYGLSDSIKLKESKKEDGST
QQTNGITNGMNGGTVFRFGRSNSLSFLGKAGEAGTLGLTGLQNLGNTCFMNSSLQCLAHT
PKLVDFFLGEYSKEINLDNPLGMKGEIALAFGDLLRSLWAPGASTVAPRTFKAKLARFAP
QFSGFNQHDSQELLAFLLDGLHEDLNRVKNKPYVEAKDGDGRPDAEVADEYWRNHVARND
SIIVDVCQGQYKSTLVCPICKKVSVMFDPFMYLSLPLPCTSMRTMDLTVMSADGSSLPIP
LTVNVPKFGKFEDLHKALVTACSLPEEETLLVTEVYNNRIIRFLEEPTDSLTLIRDGDKL
VVYRLKKDANNSPLIVYMHQKLEEQFISGKSSPTWKAFGIPLVSRLCDVENGSDVENLYL
KLLSSFKMPTEFFTENLENPTEEEATDKTDTDGTTSVEDTNSTDVKETTESLPDPVLRLY
LTDDRGNSIEAEMLKEKPVNKSKRLNVLARWPVKELDVYDTCLLSSLPEVSKSGTKRPQE
SVSLFKCLEAFLTEEPLGPDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFM
KNKLEAYVDFPLDNLDLSSYISYKNGQTTYRYMLYAISNHYGSMGGGHYTAYVHHGGDRW
YDFDDSHVHQISQEKIKTSAAYVLFYKRLVD
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggacatcgcccgacgaatctcccgattcgacaactcagcggatcgattcgttc
aacggcgagcagagagtctacttcgttcccttgaggtggtggaaagatgcgcaagattca
atgccttctgaatcagttgaaaaaagagagatcttgtatacagcaagttgcgggtcgtct
tatggaggcccaatgaagttgataaataacatttttaactctgatattttgttcgatctg
aggagagaaggagatgcgttacagaatggtgaaacgggagaagcaagcgtctcaggcagg
gactttgctttggtctcaagtgatatgtggctgcaggcactaaaatggtatcatgatgat
aaaaatactgagaaaggcgtaaaaagtttctcggctggaggagttgacagaggtgatgtt
tatcctgtacaactcaggctctccgttttgcaggaaaccaattcattggcggtcaaaatt
tgcaaaaaggacaattcagttgaatgcttcagaagagcatgcaagatattcagtttggat
tctgagcagttgcgcatttgggatatttctggccaaacaaccttgtttttcgaaagtgat
gtgagcaattccaaggattgtcaacaacaagcagatcaggaaatcctcctagagctgcag
atttatggattatcagactccatcaaattgaaggaatcaaaaaaagaagatggttccaca
cagcaaaccaatgggattaccaatggcatgaatggtggcacagtgttcagatttggacga
agtaattctttgagctttttgggtaaagctggagaagctggaactttggggttgacaggc
ttgcagaatctaggaaacacttgtttcatgaacagttcccttcagtgcttggctcacaca
ccgaagcttgtcgacttctttcttggcgagtacagtaaagaaataaatcttgacaatcca
ttgggaatgaaaggtgagatcgccttagcttttggtgacttgttaaggagtctgtgggct
ccaggtgcatcaacagtggccccaaggacatttaaagcaaaacttgctcgctttgctcct
cagtttagtggctttaatcagcatgattcgcaggagcttctagctttcttgctggatgga
ctccacgaggacttaaaccgtgtaaagaacaagccttacgtggaagcaaaagatggagat
ggccgtccagacgcagaagtggctgatgaatattggcgaaatcatgtggctcgcaatgat
tcaataattgttgatgtgtgccaaggccaatacaagtcaacattagtttgtcctatttgc
aaaaaggtttctgttatgtttgatccgttcatgtacctatcgctaccattgccatgcaca
tcaatgcgaacaatggatttaacagtcatgagtgccgatgggagtagtttgcctattcca
ttgactgtcaacgttcctaagtttggaaaatttgaagatcttcataaggctcttgtcact
gcctgttctttaccagaggaggagactttattggttactgaggtatacaacaatcggatt
attcgcttcctggaggagcctactgattcattaaccttgatcagagatggtgacaaactt
gtcgtgtatcggttaaagaaggatgcaaacaattctcctttaattgtgtatatgcatcag
aagctggaagagcagtttatatctgggaaatctagcccaacttggaaggcatttggaatc
cccttggtctcaaggctttgtgatgtcgagaatggatctgatgtcgagaacctgtacctg
aagctgcttagttcatttaagatgcctactgaattctttacagagaatcttgaaaaccca
actgaagaagaagccactgataaaacagataccgatggtactacttcagttgaggataca
aattccactgatgtgaaggagactactgaatctcttccagatcctgtgttgaggctttac
ctcaccgacgacagaggaaactcgatagaagctgaaatgttgaaagaaaagcctgtaaat
aaatccaagcggttgaatgtgcttgcacgttggcctgtaaaagagcttgacgtttatgat
acttgtcttctgagctccttacctgaggtttccaaatctggaactaagagaccccaagaa
tccgtttcgcttttcaagtgccttgaagcattcttgacggaggagcctcttggtcctgat
gacatgtggtattgtcctgggtgcaaagaacaccggcaagccattaaaaagttagatctc
tggaggttgccagagatcctggttattcatctgaagaggttttcgtatagccggtttatg
aagaacaagctggaggcatatgtggatttcccgctagataatcttgatctatcaagctac
atctcctacaagaatggtcagacaacatatcgttacatgctctatgcgattagcaatcac
tatgggagcatgggaggtggtcattacactgcatatgttcaccatggaggtgatcgatgg
tatgactttgatgatagccatgtccaccaaatcagccaagaaaagatcaagacctcggct
gcttacgttctgttctataaacgccttgtagactaa

DBGET integrated database retrieval system