KEGG   Arabidopsis thaliana (thale cress): AT5G22400Help
Entry
AT5G22400         CDS       T00041                                 

Definition
(RefSeq) Rho GTPase activating protein with PAK-box/P21-Rho-binding domain-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PBD
Motif
Other DBs
NCBI-GeneID: 832301
NCBI-ProteinID: NP_197632
MIPS: AT5G22400.1
TAIR: AT5G22400
Araport: AT5G22400
UniProt: Q9FMR1
Position
5
AA seq 466 aa AA seqDB search
MTEVLHFPSSPSASHSSSSSSSSPSPSSLSYASRSNATLLISSDHNRRNPVARFDQDVDF
HASIEEQDLRRRSSTDGGEEDDGGEDQISLLALLVAIFRRSLISCKSNRRELCSMEIGWP
TNVRHVAHVTFDRFNGFLGLPVEFEPEVPRRAPSASATVFGVSTESMQLSYDSRGNCVPT
ILLLMQNCLYSQGGLQAEGIFRLTAENSEEEAVREQLNRGFIPERIDVHCLAGLIKAWFR
ELPTSVLDSLSPEQVMQCQTEEENVELVRLLPPTEAALLDWAINLMADVVQYEHLNKMNS
RNIAMVFAPNMTQMDDPLTALMYAVQVMNFLKTLIEKTLRERQDSVVEQAHAFPLEPSDE
SGHQSPSQSLAFNTSEQSEETQSDNIENAENQSSSSEISDELTLENNACEQRETDFGKYR
TGRLSDSSQQVVLNLDPPAQWPVGRTKGLTNLSRVGSRVERTEAWR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagttcttcactttccttcatctccaagcgcttctcattcatcttcttcttct
tcttcttctccttcaccttcttctttatcttacgcctctcgctctaatgcgactctcttg
attagctctgaccacaaccggagaaacccagttgctagattcgatcaagatgttgacttt
catgcctcaatcgaagaacaagatttgagaagacggagcagtaccgatggaggagaagaa
gacgatggtggggaagatcagatttcgttgttggctcttcttgttgccattttcaggaga
tctttgatttcttgcaagagtaaccggagggagctttgtagcatggagattggatggcct
accaatgtcagacacgtggcgcacgttacctttgatcgtttcaatggcttcttgggtttg
cctgttgaattcgagcctgaagttcctagaagagctccaagcgccagtgcaacagtcttt
ggggtatcaaccgaatcaatgcaattatcgtatgattcaagaggcaattgtgtaccaacc
atactattgctgatgcaaaactgtttatatagtcaaggaggcttgcaggcagagggcatt
tttagactcactgctgagaatagtgaggaagaggcggttagggaacaattaaaccgagga
tttatacctgagcgaatcgatgttcactgtttggcagggcttatcaaggcatggtttaga
gaactgccgacaagcgttcttgattcgttgtcgcctgaacaggtgatgcagtgccaaaca
gaagaggaaaatgttgagctcgttaggcttcttccacctacagaagctgctctacttgat
tgggccatcaatctaatggcagatgttgttcagtatgaacatctaaacaagatgaattca
cgcaacatcgctatggttttcgcaccaaatatgacacagatggatgatccactgacagca
ctgatgtatgcggttcaagtgatgaactttctcaagacactaatcgaaaaaactttaaga
gaaaggcaagactcagtggtcgagcaagctcatgcattccctttagaaccgtctgatgag
agtggtcaccaaagcccttcacaatctttggcttttaacaccagtgagcagagtgaagag
acgcaatcagacaacatcgaaaatgctgaaaatcagagttcaagcagtgagatatcagac
gaattaaccctagagaacaatgcatgtgaacagagagaaacagactttggaaaatacaga
acaggaagattgagcgactcgagtcaacaggtggtgctgaatctagatcctccagctcag
tggccagtgggcagaacaaaggggttgaccaacttgagccgtgtaggatcgagggtagag
cgtactgaagcttggcggtga

DBGET integrated database retrieval system