KEGG   Arabidopsis thaliana (thale cress): AT5G22830
Entry
AT5G22830         CDS       T00041                                 

Symbol
MGT10
Name
(RefSeq) magnesium (Mg) transporter 10
  KO
K16075  magnesium transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G22830 (MGT10)
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT5G22830 (MGT10)
SSDB
Motif
Pfam: CorA DUF1373
Other DBs
NCBI-GeneID: 832346
NCBI-ProteinID: NP_001332159
TAIR: AT5G22830
UniProt: Q058N4 A0A178ULQ2
Position
5:7627597..7630993
AA seq 459 aa
MALTPIPSTFTSLFNFSDHSPYPSPSLHYLLPGSSPSFSLQLSALSRTPIYFEALKVLSR
SKCFAKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKIDSSSSSSSSDS
TSLGIREPVYEVVEVKATGAISTRKINRRQLLKSSGLRPRDIRSVDPSLFMTNSVPSLLV
REHAILLNLGSLRAIAMRDRVLIFDYNRRGGRAFVDTLMPRLNPRSMNGGPSMPFELEAV
ESALISRIQRLEQRLMDIEPRVQALLEVLPNRLTADILEELRISKQRLVELGSRAGALRQ
MLLDLLEDPHEIRRICIMGRNCTLRRGDDDLECTLPSDKLIAEEEEEEIEMLLENYLQRC
ESCHGQAERLLDSAKEMEDSIAVNLSSRRLEVSRFELLLQVGTFCVAVGALIAGIFGMNL
RSYLEEQASAFWLTTGGIIIGAAVAFFLMYSYLSRRKIF
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcgttaactccaattccttcaacattcacttctctcttcaacttctccgatcactct
ccatatccatctccatctctccattatcttcttcctggatcttctccttccttttctctc
cagttatctgcgttgagtagaactccgatctacttcgaggcacttaaagttttatcgaga
tcgaaatgtttcgccaagtctccgacaaccgccgaggatttcgtcggcgattacgaatcc
cttaacgttagcgacgacgacgatggtagtgacagtaatagtagtgatggagataacgga
ggaggaagagatgattcaaagaagatcgattcttcttcttcttcttcatcaagtgactct
acgtctctgggaattcgtgaaccggtttatgaggttgtggaagtgaaggcgactggagca
atatctacaaggaagattaacagacgacagctgcttaaatccagtggtcttcgtccaaga
gatatacgaagcgttgatccttcgttgtttatgacaaactcagtgccatctctattggtc
cgtgaacatgcgattctgctaaatttgggctccctgagagcaatagccatgcgagaccgt
gtccttatatttgattataaccggagaggaggaagagcttttgtagatacattgatgcct
cggcttaacccaagaagtatgaatggaggaccctctatgccatttgaactagaggctgtt
gaatcggcgctaatctcaaggatacaacgattagagcaaaggcttatggacattgaaccc
cgtgtccaagctctacttgaggttttacccaaccgcttaactgccgatatattggaggaa
cttcgtattagcaaacaaagactggttgaattgggctcccgagctggagctcttagacaa
atgctcctggatcttttagaggatccccatgaaatacgccgcatatgcatcatgggaaga
aattgcacacttagaagaggagacgatgatttggagtgtacattaccctcagataagctg
attgctgaggaagaagaggaggaaatcgaaatgctcttggagaactatctgcaaagatgt
gagtcatgccatggacaagcagaaagacttctggattctgcaaaggaaatggaagactca
attgctgtcaatctaagttctcggaggcttgaggtcagcaggttcgagttgcttcttcag
gtcggtacattttgtgttgcagttggtgctctcatcgcaggtatattcggcatgaacttg
aggtcctatcttgaagaacaagcttctgcattctggctaacaacgggtggaatcatcata
ggcgctgcagtcgccttctttctcatgtattcctatctcagtagacgcaaaatcttttga

DBGET integrated database retrieval system