KEGG   Arabidopsis thaliana (thale cress): AT5G23740Help
Entry
AT5G23740         CDS       T00041                                 

Gene name
RPS11-BETA
Definition
(RefSeq) ribosomal protein S11-beta
  KO
K02949  small subunit ribosomal protein S11e
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Module
ath_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT5G23740 (RPS11-BETA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT5G23740 (RPS11-BETA)
Ribosome [BR:ath03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    AT5G23740 (RPS11-BETA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 832439
NCBI-ProteinID: NP_197763
MIPS: AT5G23740.1
TAIR: AT5G23740
Araport: AT5G23740
UniProt: P42733 A0A178UPD3
Position
5
AA seq 159 aa AA seqDB search
MAEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCP
FTGTVSIRGRILAGTCHSAKMQRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGASAFGKKAFTGV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagactgagaaagcttttcttaagcaacccaaggtcttccttagctcgaag
atatctgggaaaggaaagagacctggtaaaggtggaaaccgtttctggaagaacattggt
ttgggtttcaagactcctcgtgaagccattgatggagcttacattgacagtaaatgtcca
ttcactggaaccgtttctatcagaggacgtatcttagctggtacttgccacagtgccaag
atgcagagaaccatcattgttcgtaggaattaccttcactttgtgaagaagtatcaacga
tatgagaagagacattccaacatccctgcccatgtctcaccgtgtttccgtgtcaaggaa
ggtgaccatgtcatcattggccaatgcaggccgttgtcgaagacggttaggttcaatgtg
ctgaaggtgattccagcgggtgcatctgcctttggtaaaaaggccttcactggagtgtaa

DBGET integrated database retrieval system