KEGG   Arabidopsis thaliana (thale cress): AT5G23810
Entry
AT5G23810         CDS       T00041                                 
Symbol
AAP7
Name
(RefSeq) amino acid permease 7
  KO
K24917  amino acid permease
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT5G23810 (AAP7)
Transporters [BR:ath02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AT5G23810 (AAP7)
SSDB
Motif
Pfam: Aa_trans Trp_Tyr_perm DUF1516
Other DBs
NCBI-GeneID: 832446
NCBI-ProteinID: NP_197770
TAIR: AT5G23810
UniProt: Q9FF99
Position
5:8028238..8030888
AA seq 467 aa
MDIKEDDESRVITPTELQLHDSVTARTGTLWTAVAHIITGVIGAGVLSLAWATAELGWIA
GPAALIAFAGVTLLSAFLLSDCYRFPDPNNGPLRLNSYSQAVKLYLGKKNEIVCGVVVYI
SLFGCGIAYTIVIATCSRAIMKSNCYHRNGHNATCSYGDNNNYFMVLFGLTQIFMSQIPN
FHNMVWLSLVAAIMSFTYSFIGIGLALGKIIENRKIEGSIRGIPAENRGEKVWIVFQALG
NIAFSYPFSIILLEIQDTLRSPPAEKQTMKKASTVAVFIQTFFFFCCGCFGYAAFGDSTP
GNLLTGFGFYEPFWLVDFANACIVLHLVGGYQVYSQPIFAAAERSLTKKYPENKFIARFY
GFKLPLLRGETVRLNPMRMCLRTMYVLITTGVAVMFPYFNEVLGVVGALAFWPLAVYFPV
EMCILQKKIRSWTRPWLLLRGFSFVCLLVCLLSLVGSIYGLVGAKFG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacattaaagaagatgacgagtctcgagttataacaccaaccgagcttcaacttcat
gattcagttactgcaagaacaggaacgttatggacggcggtggcacatataataacagga
gtgataggagctggagtgttgtcgttggcttgggccacggcggagctcggctggatcgct
ggtccggccgcccttatagccttcgccggggtcacacttctctctgcttttcttctttcc
gattgctaccgtttccctgatcctaacaacggtcccctccgactcaattcttactctcaa
gccgttaaattgtatttagggaagaagaatgaaattgtatgtggagtcgttgtatacatt
tccctttttggttgtggcattgcttataccattgttatagctacatgcagtagagcaatt
atgaaatcgaattgttatcatagaaatggacacaatgcaacatgttcatatggagacaac
aacaactacttcatggttttgtttggtttgactcagatatttatgtcacaaatacctaat
ttccacaacatggtatggctctctcttgtcgccgctattatgtcttttacttactcgttc
attggcatcggcctcgcccttggcaaaatcatagagaatcgaaaaattgagggaagtata
aggggaataccagcagaaaacagaggtgaaaaggtatggatagtgttccaagctcttggg
aacattgccttttcatatcctttctcaatcatacttcttgagattcaggacacattgaga
tcaccaccggcagagaagcaaacgatgaagaaagcctcgacggttgcggtattcatccaa
acattcttcttcttctgttgtggatgttttgggtacgcggcctttggagattccaccccg
ggaaatctcttgaccggtttcggcttctatgagccattctggctcgtcgatttcgccaac
gcttgcattgttcttcatttagttggtggatatcaggtatacagtcaaccaattttcgcg
gctgcggagagatcgctaaccaagaaatatccggaaaataagtttatcgccagattctac
ggattcaaactgccattgttgcgaggagagacggtgagattgaacccaatgaggatgtgt
ttgagaacgatgtacgtgttgatcacaacgggagtggcagtgatgtttccctacttcaat
gaagtattaggagtggtgggggcacttgcattttggcctctggcagtgtattttcctgtg
gagatgtgtatattgcagaagaaaatccgaagttggacgcgaccatggcttcttcttaga
ggtttcagctttgtgtgcttgctcgtctgtctcttgtctcttgttggatctatttatgga
cttgttggagctaaattcggatga

DBGET integrated database retrieval system