KEGG   Arabidopsis thaliana (thale cress): AT5G24150
Entry
AT5G24150         CDS       T00041                                 
Symbol
SQP1
Name
(RefSeq) FAD/NAD(P)-binding oxidoreductase family protein
  KO
K00511  squalene monooxygenase [EC:1.14.14.17]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00100  Steroid biosynthesis
ath00909  Sesquiterpenoid and triterpenoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AT5G24150 (SQP1)
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    AT5G24150 (SQP1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.17  squalene monooxygenase
     AT5G24150 (SQP1)
SSDB
Motif
Pfam: SE FAD_binding_3 DAO NAD_binding_8 FAD_binding_2 GIDA Pyr_redox_2 Thi4 FAD_oxidored Pyr_redox ApbA 3HCDH_N HI0933_like NAD_Gly3P_dh_N TrkA_N HcgC Shikimate_DH Lycopene_cycl
Other DBs
NCBI-GeneID: 832480
NCBI-ProteinID: NP_197803
TAIR: AT5G24150
UniProt: O65404 B9DFB1
Position
5:complement(8172300..8175525)
AA seq 516 aa
MAFTNVCLWTLLAFMLTWTVFYVTNRGKKATQLADAVVEEREDGATDVIIVGAGVGGSAL
AYALAKDGRRVHVIERDLREPERIMGEFMQPGGRLMLSKLGLEDCLEGIDAQKATGMTVY
KDGKEAVASFPVDNNNFPFDPSARSFHNGRFVQRLRQKASSLPNVRLEEGTVKSLIEEKG
VIKGVTYKNSAGEETTALAPLTVVCDGCYSNLRRSLNDNNAEVLSYQVGFISKNCQLEEP
EKLKLIMSKPSFTMLYQISSTDVRCVFEVLPNNIPSISNGEMATFVKNTIAPQVPLKLRK
IFLKGIDEGEHIKAMPTKKMTATLSEKKGVILLGDAFNMRHPAIASGMMVLLSDILILRR
LLQPLSNLGNAQKISQVIKSFYDIRKPMSATVNTLGNAFSQVLVASTDEAKEAMRQGCYD
YLSSGGFRTSGMMALLGGMNPRPISLIYHLCAITLSSIGHLLSPFPSPLRIWHSLRLFGL
AMKMLVPHLKAEGVSQMLFPVNAAAYSKSYMAATAL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggcctttacgaacgtttgcctatggacgctactcgccttcatgctgacttggacagtg
ttctacgtcacaaacagggggaagaaggcgacgcagttggcggatgcggtggttgaagag
cgagaagacggtgctactgacgttatcatcgttggggctggagtaggcggctcggctctc
gcatatgctcttgctaaggacgggcgtcgagtccatgtaatagagagggacctgagagaa
ccagagagaatcatgggtgagtttatgcaaccaggaggacgactcatgctctctaagctt
ggtcttgaagattgtttggagggaatagatgcccaaaaagccacgggcatgacagtttat
aaggacggaaaagaagcagtcgcatcttttcccgtggacaacaacaattttccttttgat
ccttcggctcgatcttttcacaatggccgattcgtccaacgattgcggcaaaaggcttct
tctcttcccaatgtgcgcctggaagaaggaacggtgaagtctttgatagaagaaaaagga
gtgatcaaaggagtgacatacaaaaatagcgcaggcgaagaaacaacagccttggcacct
ctcactgtagtatgcgacggttgctactcaaaccttcgccggtctcttaatgacaacaat
gcggaggttctgtcataccaagttggttttatctcaaagaactgtcagcttgaagaaccc
gaaaagttaaagttgataatgtctaaaccctccttcaccatgttgtatcaaatcagcagc
accgacgttcgttgtgtttttgaagttctccccaacaacattccttctatttcaaatggt
gaaatggctactttcgtgaagaacactattgctcctcaggtacctttaaaactccgcaaa
atatttttgaaagggattgatgaaggagaacatataaaagccatgccaacaaagaagatg
acagctactttgagcgagaagaaaggagtgattttattgggagatgcattcaacatgcgt
catccagcaatcgcatctggaatgatggttttattatctgacattctcattctacgccgt
cttctccagccattaagcaaccttggcaatgcgcaaaaaatctcacaagttatcaagtcc
ttttatgatatccgcaagccaatgtcagcgacagttaacacgttaggaaatgcattctct
caagtgctagttgcatcgacggacgaagcaaaagaggcaatgagacaaggttgctatgat
tacctctctagtggtgggtttcgcacgtcagggatgatggctttgctaggcggcatgaac
cctcgtccgatctctctcatctatcatctatgtgctatcactctatcctccattggccat
ctactctctccatttccctctccccttcgcatttggcatagccttcgactttttggtttg
gctatgaaaatgttggttccccatctcaaggctgaaggagttagccaaatgttgtttcca
gtcaacgccgccgcgtatagcaaaagctatatggctgcaacggctctctaa

DBGET integrated database retrieval system