KEGG   Arabidopsis thaliana (thale cress): AT5G24470
Entry
AT5G24470         CDS       T00041                                 

Gene name
PRR5
Definition
(RefSeq) two-component response regulator-like protein
  KO
K12130  pseudo-response regulator 5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G24470 (PRR5)
SSDB
Motif
Pfam: Response_reg CCT
Other DBs
NCBI-GeneID: 832518
NCBI-ProteinID: NP_568446
MIPS: AT5G24470.1
TAIR: AT5G24470
UniProt: Q6LA42 A0A654G3T3
Position
5
AA seq 558 aa
MTSSEEVVEVTVVKAPEAGGGKLSRRKIRKKDAGVDGLVKWERFLPKIALRVLLVEADDS
TRQIIAALLRKCSYRVAAVPDGLKAWEMLKGKPESVDLILTEVDLPSISGYALLTLIMEH
DICKNIPVIMMSTQDSVNTVYKCMLKGAADYLVKPLRRNELRNLWQHVWRRQTSLAPDSF
PWNESVGQQKAEGASANNSNGKRDDHVVSGNGGDAQSSCTRPEMEGESADVEVSARDAVQ
MECAKSQFNETRLLANELQSKQAEAIDFMGASFRRTGRRNREESVAQYESRIELDLSLRR
PNASENQSSGDRPSLHPSSASAFTRYVHRPLQTQCSASPVVTDQRKNVAASQDDNIVLMN
QYNTSEPPPNAPRRNDTSFYTGADSPGPPFSNQLNSWPGQSSYPTPTPINNIQFRDPNTA
YTSAMAPASLSPSPSSVSPHEYSSMFHPFNSKPEGLQDRDCSMDVDERRYVSSATEHSAI
GNHIDQLIEKKNEDGYSLSVGKIQQSLQREAALTKFRMKRKDRCYEKKVRYESRKKLAEQ
RPRIKGQFVRQVQSTQAP
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgactagtagcgaggaagtagttgaagtgacggtggttaaagcacctgaagctggcgga
ggaaagttatcacgtcggaagattcggaagaaagacgccggtgttgatggtttggtgaag
tgggagagatttctcccgaaaatcgcgcttagagttttgctcgttgaagctgatgattct
actagacagattatcgctgctcttctcaggaaatgtagttacagagttgctgcagtacct
gatggcttaaaagcttgggagatgctaaaaggaaagcctgaaagtgttgatttgatatta
acagaggttgatctaccttcaatatctggatatgctctgctaacacttatcatggagcat
gatatttgcaagaacattcctgttataatgatgtcgacacaggactcggtgaatactgtg
tataagtgtatgttgaaaggtgcggctgattatcttgttaagccgttgaggaggaatgag
cttagaaatctttggcagcatgtctggagaagacaaacttcacttgctcctgatagcttt
ccatggaatgagagtgttggacagcagaaagccgagggtgcgtctgcaaacaactcgaac
ggaaagagagacgatcatgttgtgagtgggaatggtggtgatgcccagagctcgtgtaca
agaccagagatggaaggtgagagcgcagacgtggaggttagtgcgagagacgcagtacag
atggagtgcgcaaagtctcagtttaatgagacacggcttctagcaaatgagttgcagagt
aagcaagcagaagccattgacttcatgggagcatcgtttagaagaactggacgacgtaac
agagaagaaagtgttgctcaatacgaatctcggatagagcttgatctttctctgagaaga
cctaatgcttctgagaaccaatcttctggagaccggccttctcttcatccttctagtgcc
tcagctttcacacggtacgttcacaggccgttgcagacacaatgttcagcctccccagtg
gttactgatcaaagaaagaatgttgcagcaagtcaagatgataacattgtgctaatgaac
caatacaatacatctgaaccgcctccaaatgctccaagaagaaacgacaccagcttttac
actggagctgactcacctggtccaccgtttagtaatcagctgaattcttggccgggacag
agttcataccctacgccaacccctatcaacaatatacagttcagagatcccaacacagct
tatacatctgcaatggctcctgcttcactctccccaagccctagttccgttagcccgcat
gagtacagttccatgtttcacccattcaacagtaaacccgaggggttacaagaccgggat
tgttccatggatgtagatgagaggagatacgtctcttctgcaaccgaacatagtgcaata
ggcaatcacattgatcagcttattgagaagaagaacgaagatggctattcattatccgtc
gggaaaattcagcaatctcttcaacgagaagccgctttaaccaaattccgaatgaagcga
aaggacagatgttatgagaaaaaggttcgttacgagagccggaagaaattagcagagcaa
cgaccacgaatcaaaggccaattcgttcgtcaagtccaatccacacaagctccatag

DBGET integrated database retrieval system