KEGG   Arabidopsis thaliana (thale cress): AT5G27140Help
Entry
AT5G27140         CDS       T00041                                 

Definition
(RefSeq) NOP56-like pre RNA processing ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT5G27140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT5G27140
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    AT5G27140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT DUF4366
Motif
Other DBs
NCBI-GeneID: 832772
NCBI-ProteinID: NP_001330282
MIPS: AT5G27140.1
TAIR: AT5G27140
Araport: AT5G27140
UniProt: O04656
Position
5
AA seq 450 aa AA seqDB search
MLVLFETSGGFALFKVLDEGKLSNVEDLGTEFYSAESARRMGLHKFLKNNCDDGEILAVA
DPKLGDIITEKLDIECVHNDAVMELLRGVRSQLTELLSGLDDNDLAPVSLELSHILARYK
LKITSDKVETMIILSISLLDDLDKELNTYTTSVCELYGLHFPELANIVQDNILYAKVVKL
MGNRINAATLDFSEILADEVEAELKEASMVSTRTEVSDLDLMHIQELCDQVLSIAEDKTL
LCDDLKNKMNKIAPNLTALVGELVGARLISHCGSLWNLSKLPWSTIQILGAEKTLYKALK
TKQATPKYGLIYHAPLVRQAAPENKGKIARSLAAKSALAIRCDAFGNGQDNTMGVESRLK
LEARLRNLEGGDLGACEEEEEVNDKDTKKEADDEEEPKTEECSKKRKKEAELETVEDPAK
KSKQEGVTGLLLLMLLISLIYFFSVNQLLW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtactgtttgagacgtcaggtggttttgcactctttaaagtattagatgaagga
aagctctctaatgttgaggatttgggtactgagttctactctgcagagtcagctcgaagg
atgggtctacacaagtttttgaaaaataactgtgatgatggtgaaatcttagctgtggct
gatccaaagcttggagatatcatcacagagaaactggacatagaatgtgttcacaacgat
gctgttatggagctgttacgaggtgtgagaagtcagttaaccgaacttttatccggattg
gatgataatgatttagctccagtgagcttggaattgtctcacatccttgctagatataaa
ctaaaaatcacctctgacaaggtggagaccatgataatcctatctatcagtctgcttgat
gatcttgacaaagagcttaacacttacactacgagcgtttgtgaattgtacggtttgcat
tttcccgagcttgctaatattgtacaggacaatatcttatatgccaaggtggttaaacta
atggggaatcggattaatgctgcaacgctagacttctctgagatattggctgatgaagtt
gaagcagaactaaaagaggcttctatggtgtctacgagaactgaagtcagtgaccttgat
ttgatgcacatccaagaactctgtgaccaagttctttcaatcgctgaggacaaaactctg
ctttgtgacgacttgaagaacaaaatgaacaaaattgcaccaaatctaactgcccttgtc
ggggagctagtcggtgctcgcttaatatctcattgtggtagtttatggaacctctcaaag
ctaccatggagcacaattcagattcttggagctgaaaagaccctatataaagcccttaag
accaaacaagccactccaaagtatggtttaatctaccacgcacctttggttaggcaagct
gcaccagagaacaagggtaaaatcgcacgttcactagctgcaaaatctgctcttgctatc
cggtgtgatgcttttggtaatggccaagacaacactatgggagtcgaaagccgcttaaag
cttgaagcgcgcttgagaaatcttgaaggaggagatttaggagcatgcgaagaagaagaa
gaagttaatgacaaagatacaaagaaggaggctgatgatgaggaagaacccaaaactgag
gagtgttcgaagaagaggaagaaagaagcagaacttgaaaccgtggaagatcccgcaaag
aagagcaaacaagagggtgtaacaggattattactcctgatgcttttaatttctctaatc
tatttcttttctgttaaccagttgctatggtaa

DBGET integrated database retrieval system