KEGG   Arabidopsis thaliana (thale cress): AT5G27360Help
Entry
AT5G27360         CDS       T00041                                 

Gene name
SFP2
Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 832795
NCBI-ProteinID: NP_568494
MIPS: AT5G27360.1
TAIR: AT5G27360
Araport: AT5G27360
UniProt: Q94CI6
Position
5
AA seq 478 aa AA seqDB search
MHKMMVVEKERSIEERLLQLKNQNDDSECRITACVILSTFIAVCGSFSFGVSLGYTSGAE
IGIMKDLDLSIAQFSAFASLSTLGAAIGALFSGKMAIILGRRKTMWVSDLLCIIGWFSIA
FAKDVMWLNFGRISSGIGLGLISYVVPVYIAEISPKHVRGTFTFTNQLLQNSGLAMVYFS
GNFLNWRILALLGALPCFIQVIGLFFVPESPRWLAKVGSDKELENSLLRLRGGNADISRE
ASDIEVMTKMVENDSKSSFCDLFQRKYRYTLVVGIGLMLIQQFSGSSAVLSYASTILRKA
GFSVTIGSTLLGLFMIPKAMIGVILVDKWGRRPLLLTSVSGMCITSMLIGVAFTLQKMQL
LPELTPVFTFICVTLYIGTYAIGLGGLPWVIMSEIFPMNIKVTAGSIVTLVSWSSSSIVT
YAFNFLLEWSTQGTFYVFGAVGGLALLFIWLLVPETKGLSLEEIQASLIREPDRINQS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatgatggtggtggagaaagaaagaagcatagaagaaaggcttttgcagctc
aagaaccaaaacgacgattcagaatgtcgtattactgcttgtgttatccttagtactttc
atcgctgtgtgtggttctttctcctttggtgtctctcttggttatacttcaggtgcagag
ataggaattatgaaggacttggatctttctatcgcgcaattttcagcatttgcttcatta
tccactttgggagctgcaattggagctttgtttagcggtaaaatggcgatcatccttggc
agaagaaaaacaatgtgggtgtccgatctcctctgtatcattggttggttctccatcgct
ttcgctaaggatgtgatgtggttgaacttcggaagaatctcctcagggataggactcggc
ttaattagctatgtggtacctgtctatatagcagaaatttcaccaaaacatgttcgtggt
acatttacctttacaaatcagctccttcaaaactctggactcgcaatggtttatttttct
gggaattttctcaactggaggatattggctttattaggtgctttaccatgcttcattcaa
gtaatcggtttattcttcgtaccagagtccccaagatggctggcaaaagttggctccgat
aaagaactagaaaattcacttcttcgtcttagggggggaaatgctgatatttcacgtgaa
gcctcagacattgaagttatgaccaaaatggtagaaaatgattcaaagtcgagtttttgt
gatttgttccagagaaaatatagatacactctcgtggtaggaatcgggctaatgttgata
caacaattttcaggaagttctgcagtgctctcatatgccagtaccattttacggaaagca
ggtttttcggtgaccattggatcgacgctactaggtctcttcatgataccaaaagccatg
attggtgtcattcttgtcgataaatggggcagacggcctctcttgttgacttctgtatct
gggatgtgcataacttccatgcttattggagtcgccttcacattacagaaaatgcaattg
ctaccggagctaacaccagtattcacgtttatatgcgttacgctgtatattggaacttat
gctataggcttgggaggccttccttgggtaattatgtctgagatatttccaatgaatata
aaagtaactgcaggaagtatagtaacgttagtatcatggtcaagtagttcgatcgtcact
tatgctttcaactttctgctcgagtggagcactcaaggaacattttacgtatttggagca
gtcggaggactagcattgctttttatttggttgctcgttccggaaacgaaaggattatca
cttgaagaaatacaagcttcgcttattcgtgagcccgatagaataaatcaaagttag

DBGET integrated database retrieval system