KEGG   Arabidopsis thaliana (thale cress): AT5G28030Help
Entry
AT5G28030         CDS       T00041                                 

Gene name
DES1
Definition
(RefSeq) L-cysteine desulfhydrase 1
  KO
K01738  cysteine synthase A [EC:2.5.1.47]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00270  Cysteine and methionine metabolism
ath00920  Sulfur metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AT5G28030 (DES1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT5G28030 (DES1)
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     AT5G28030 (DES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP PRMT5
Motif
Other DBs
NCBI-GeneID: 832873
NCBI-ProteinID: NP_001330588
MIPS: AT5G28030.1
TAIR: AT5G28030
Araport: AT5G28030
UniProt: F4K5T2
Position
5
AA seq 323 aa AA seqDB search
MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE
DKGLITPGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHL
TDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVA
GVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLS
IVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSG
GERYLSTELFESVRYEAENLPVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccgcgtcttgatcaagaacgatgtcactgaattgataggtaacacaccaatg
gtgtatctaaataaaattgtggatggttgtgtggctcgtattgctgccaagcttgagatg
atggagccttgctctagcatcaaagatagaatcgcatatagtatgatcaaagatgctgaa
gacaaaggattgattactccgggaaagagtacattgattgaggcaacgggtggtaacacc
gggattggtttagccagcatcggggcttcaagaggttataaagtgatccttttgatgcct
tcaacaatgagtttagaaaggagaatcattctaagagcattaggtgcagaggttcatctc
actgacattagcataggcattaaaggacagttggagaaagctaaagagatattaagcaaa
actcccggtggttacataccacaccagtttattaatcctgaaaatccagagattcattat
agaaccacgggtccggagatttggagagattcagcagggaaagtagatatcttagtcgcc
ggtgttggaactggtggaacggttactggaacagggaagtttcttaaagaaaagaacaaa
gatattaaggtttgtgtggtggaaccttccgaaagtgcggtactcagcggaggaaaacca
ggtccacatttgatccaaggaataggctctggtgaaattccagccaatttggacttaagc
attgttgatgaaatcattcaagtgactggtgaggaagctattgaaacaaccaagcttctt
gctatcaaagaaggattattggttggaatatcctctggagcctcagctgcggctgcgtta
aaggttgcaaagcggcctgaaaacgtagggaaactcattgtggttatttttcctagtgga
ggagaacgttatttatcgactgaattgttcgagtcagtcagatatgaagctgagaatttg
ccagttgaatga

DBGET integrated database retrieval system