KEGG   Arabidopsis thaliana (thale cress): AT5G30510
Entry
AT5G30510         CDS       T00041                                 
Symbol
RPS1
Name
(RefSeq) ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT5G30510 (RPS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT5G30510 (RPS1)
Ribosome [BR:ath03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    AT5G30510 (RPS1)
  Bacteria
    AT5G30510 (RPS1)
SSDB
Motif
Pfam: S1
Other DBs
NCBI-GeneID: 833138
NCBI-ProteinID: NP_850903
TAIR: AT5G30510
UniProt: Q93VC7 A0A178ULV9
Position
5:complement(11619000..11621298)
AA seq 416 aa
MASLAQQFSGLRCSPLSSSSRLSRRASKNFPQNKSASVSPTIVAAVAMSSGQTKERLELK
KMFEDAYERCRTSPMEGVAFTVDDFAAAIEQYDFNSEIGTRVKGTVFKTDANGALVDISA
KSSAYLSVEQACIHRIKHVEEAGIVPGMVEEFVIIGENESDDSLLLSLRNIQYELAWERC
RQLQAEDVIVKAKVIGANKGGLVALVEGLRGFVPFSQISSKAAAEELLEKEIPLKFVEVD
EEQTKLVLSNRKAVADSQAQLGIGSVVLGVVQSLKPYGAFIDIGGINGLLHVSQISHDRV
SDIATVLQPGDTLKVMILSHDRDRGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFR
QRIAQAEAMARADMLRFQPESGLTLSSDGILGPLGSELPDDGVDLTVDDIPSAVDI
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcgtctttggctcagcaattctcgggattgagatgttccccactctcttcttcttct
aggttatcgaggagagcttcgaagaactttccccagaacaaatctgcctctgtttctccg
actattgtcgccgcggttgcaatgtctagcggtcaaacaaaggagcgtcttgagctgaag
aagatgttcgaagatgcttatgaacgatgtagaacttctcctatggaaggtgttgctttc
accgtcgacgatttcgctgctgctattgaacaatacgacttcaattccgaaatcggcact
agggtaaaaggaacagtgttcaagactgatgcaaatggtgcattagttgacatttctgca
aagtcatcggcttacttgtcggtagaacaagcgtgtattcatagaattaagcatgtggaa
gaagctggtattgtacctggtatggtggaagagtttgtcatcattggtgaaaatgaaagt
gatgacagtttgctattgagcttaaggaatattcaatacgaacttgcttgggaacgttgc
aggcagcttcaggctgaggatgttattgtcaaggctaaggttattggtgctaacaaaggt
ggattggttgctcttgtggaaggtcttcgtggatttgtgcccttttcgcagatatcatcg
aaagcagcagctgaagagcttcttgaaaaagaaatacctcttaagtttgtggaggttgat
gaggaacaaacaaagcttgtcctcagcaaccgtaaagctgtagcagatagccaagctcag
cttggaattggatctgtggtcctcggagttgttcagagcttgaaaccttatggtgccttc
attgacattggtggaatcaatgggcttcttcatgtcagtcagataagtcatgaccgtgtc
tcagatatcgcaactgttcttcagcctggtgacactttgaaggttatgatattgagtcac
gaccgtgacagaggaagagtaagtctctccacaaagaagctggagccaacacctggtgat
atgattcgtaacccaaaacttgtgttcgagaaggctgaggagatggctcagacattcaga
cagagaattgcgcaagcagaagccatggctcgtgcagacatgcttcgcttccaacctgag
agtggactgacgctgagttctgacgggatactaggaccactcggatctgagttaccagat
gatggcgtagatctaacggtcgacgacattccttctgcagttgatatttag

DBGET integrated database retrieval system