KEGG   Arabidopsis thaliana (thale cress): AT5G38990
Entry
AT5G38990         CDS       T00041                                 

Name
(RefSeq) Malectin/receptor-like protein kinase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Malectin_like Malectin Syndecan Cadherin_C_2 Kinase-like APH EphA2_TM Haspin_kinase
Other DBs
NCBI-GeneID: 833891
NCBI-ProteinID: NP_198715
TAIR: AT5G38990
UniProt: Q9FID9 A0A5S9Y989
Position
5:15608685..15611664
AA seq 880 aa
MICHVLVIFTILVSAVVDATASYEPTDVFLINCGDTSNNMDYSGRNWTTENPKFMSSNAV
DDASFTSSASYQESGIPQVPYLKARIFRYDFTYSFPVSPGWKFLRLYFYPTRYGSDFDAV
KSFFSVNVNRFTLLHNFSVKASIPESSSLIKEFIVPVNQTLDLTFTPSPNSLAFVNGIEI
ISMPDRFYSKGGFDDVVRNVGRDVDFEIDNSTAFETVYRVNVGGKVVGDVGDSGMFRRWL
SDEGFLLGINSGAIPNITGVKINYTDKTPAYVAPEDVYTTCRLMGNKDSPELNLNFNLTW
LFEVDAGFAYIVRLHFCETQPEVNKTGDRVFSIFFGYQLAMREMDVFRLSGGFRLPMYLD
FKVLVDADGTSQRPSLRVDLTPYKEDYPTYYDAILSGVEILKLSNSDGNLAGLNPIPQLS
PPPQSITPLKGKGKSSHVLPIIIAVVGSAVALAFFVLVVVLVVMKRKKKSNESSVDTTNK
PSTNSSWGPLLHGTGSTNTKSASSLPSDLCRRFSIYEIKSATNDFEEKLIIGVGGFGSVY
KGRIDGGATLVAVKRLEITSNQGAKEFDTELEMLSKLRHVHLVSLIGYCDDDNEMVLVYE
YMPHGTLKDHLFRRDKASDPPLSWKRRLEICIGAARGLQYLHTGAKYTIIHRDIKTTNIL
LDENFVAKVSDFGLSRVGPTSASQTHVSTVVKGTFGYLDPEYYRRQILTEKSDVYSFGVV
LLEVLCCRPIRMQSVPPEQADLIRWVKSNFNKRTVDQIIDSDLTADITSTSMEKFCEIAI
RCVQDRGMERPPMNDVVWALEFALQLHETAKKKNDNVESLDLMPSGEVGTTTDGEDDLFS
RTTGHVGKSTTTDDSVLVVGDERSGSSWGVFSEINEPKAR
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgatctgtcacgttttagtaattttcactattctcgtttccgccgtcgtcgacgcaacg
gcgtcgtatgagcccactgatgtctttctcatcaattgcggcgatacctccaacaacatg
gactacagtggccggaactggacgacggagaatccgaaatttatgtcatcgaatgcagtt
gacgacgcgtcgttcacttcatctgcgtcataccaagaatcagggattcctcaagtgccg
tacttgaaagctaggattttccgatatgatttcacttacagttttccagtctctcccggc
tggaaattcctccggttatacttttatccgacccgttacggatccgatttcgacgccgtt
aaatccttcttctccgtcaacgtcaaccgtttcactctcttgcataacttcagtgtaaaa
gcttccataccggagtcaagttctctaatcaaagagtttatcgttccggttaaccaaact
cttgatctcacgttcacgccctctccgaattcattagctttcgttaacggaatcgagatt
atctccatgcctgaccggttttactcaaagggaggatttgacgacgttgtaagaaacgtt
ggtagggacgttgacttcgagatagacaactccacggctttcgagaccgtttatcgggta
aacgtaggtggaaaagtggtgggcgacgtcggagattcgggaatgttccggcgttggctt
tccgatgaaggtttcttactcggtattaattcgggagccattccgaatataacaggtgta
aagatcaactacacggataaaactcccgcgtacgttgcgccggaagatgtatacacgacg
tgtcgcctgatggggaacaaagacagtcctgagctaaacctgaatttcaacctgacgtgg
ctctttgaagtcgatgccgggtttgcctatatagtgaggcttcatttctgtgagacgcaa
ccggaagtcaacaaaacgggtgaccgcgtcttctccatcttcttcggatatcaactggcc
atgcgtgaaatggacgtgtttcggctgagtggtggttttcggctaccgatgtatctagat
ttcaaggtacttgtcgacgccgacggaactagccagagacctagtcttcgagttgacttg
acaccttacaaagaggactatccaacctattacgacgctattttgagtggtgtagagatt
ctcaagctgagtaattctgatggtaatcttgcggggcttaatccaattcctcaactaagt
ccaccaccacaatctataacgccactaaaaggaaaaggcaagtcatcacatgttttgcca
ataataattgcagtggttggttctgcagttgcgctagcgttttttgttcttgttgttgtc
ctcgttgttatgaagagaaagaagaagagcaacgagtctagtgtagataccacgaacaag
ccttctacgaactcgtcatggggtcctcttctgcacgggacaggctctacaaatacaaaa
tctgcctcatctcttccatcagatctctgccgtcgattctccatctacgaaatcaaatcc
gccacaaatgatttcgaggaaaaactaatcataggagtaggcgggtttggttctgtctac
aaaggacgaatagacggtggagccacacttgttgcggttaaacggctggaaattacatcg
aaccaaggtgctaaagagttcgatacagagctcgagatgctttcaaagcttcgacatgta
cacctcgtctctctaatcggatattgcgatgacgacaacgagatggtacttgtctatgag
tatatgccacatggtacacttaaagatcatcttttcaggagagacaaggcctctgatcct
ccattgtcatggaaacgaaggctagagatttgcattggagcagctcgtggattacagtat
cttcatactggagccaagtacacgatcatacatagagacatcaaaaccacaaacatactt
ctcgatgagaacttcgtcgctaaagtatctgactttggtttatcaagagttggtcctact
agtgcttctcaaacgcatgtctccaccgtcgttaaaggaacgtttggttacttggatccc
gagtactatcgccgtcaaatcttgaccgaaaaatccgacgtgtactcttttggagttgtt
ctgttggaggttttgtgctgtagaccgatcagaatgcaaagtgttccaccggaacaagca
gatttgatccgatgggtgaagtcaaatttcaataaaagaaccgttgatcagatcattgac
tcagatttaaccgctgatatcacttcgacctcgatggagaagttttgtgagatagccatt
agatgtgttcaagaccgtggtatggaacggccaccgatgaacgacgttgtttgggcgctt
gagtttgctcttcagcttcacgagactgctaagaagaagaatgacaacgtggagtctctg
gatctaatgccaagtggtgaagttggtacgaccacggacggagaagatgacttgtttagt
aggactacaggacacgttgggaaatcgaccacgaccgatgactctgttctagttgttggt
gatgagaggagtggttcgagttggggagtattttcggagatcaatgaacctaaagcacgg
tag

DBGET integrated database retrieval system