KEGG   Arabidopsis thaliana (thale cress): AT5G39040
Entry
AT5G39040         CDS       T00041                                 
Symbol
ABCB27
Name
(RefSeq) transporter associated with antigen processing protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA AAA_16 ABC_ATPase AAA_18 AAA_22 DUF5305
Other DBs
NCBI-GeneID: 833896
NCBI-ProteinID: NP_198720
TAIR: AT5G39040
UniProt: Q0WML0 A0A654G6G7
Position
5:15625460..15629835
AA seq 644 aa
MGNKKLLTGGSSKTHGSGSSYRDPLLQNQEDKPKANGSENGLNDLEHGVVEAANVGFGRV
FALAKPDAGKLVIGTIALLIGSTTNLLVPKFGGMIIDIVSRDVKTPEQQTESLIAVRNAV
VIILLIVVIGSICTALRAWLFNSASERVVARLRKDLFRHLMHQEIAFYDVTKTGELLSRL
SEDTQIIKNAATTNLSEALRNVTTALIGVGFMFTSSWKLTLLALVVVPVISVAVKQFGRY
LRELSHTTQAAAAVAASIAEESFGAVRTVRSFAKESYMVSQYSKKVDETLKLGLKQAVLV
GLFFGGLNAAFTLSVITVVSYGAYLTIYGSMTVGALTSFILYSLTVGSSVSSLSSLYTTA
MKAAGASRRVFQILDRVSSMSSSGDKCPVGNPDGDVELNDVWFAYPSRPSHMILKGISLR
LTPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVSLMEISHQYLHKQISIVSQE
PILFNCSVEENIAYGFDGEASFTDIENAAKMANAHEFIEAFPDKYNTVVGERGLRLSGGQ
KQRIAIARALLTNPSVLLLDEATSALDAESEYLVQDAMDSLMAGRTVLVIAHRLSTVKTA
DCVAVISDGEVAEKGTHDELLSLNGIYTNLVKRQLQSSSSVTTL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgggcaacaagaaactgttgactggtgggtcaagcaaaactcatggtagtggtagtagc
tacagagatcctctgttgcagaatcaggaggataaaccgaaagcgaatggaagcgagaat
ggtttgaatgatcttgagcatggtgtagttgaggcggcaaatgttggatttggcagagtc
tttgcgttggcaaagcccgatgcgggaaagctagtgattggtaccattgctttgttgata
ggttcaacaactaatctccttgttccaaagtttggtgggatgattatagacattgtatcc
agagatgtcaagacgcctgagcagcaaacggaatccttgattgctgttagaaacgccgta
gtaatcattttgcttatcgttgtaatcggatcgatatgcacggctttgcgagcgtggcta
tttaattctgccagtgaaagagttgtggctcgactgagaaaggatttgttcagacaccta
atgcatcaggaaatagcattttatgatgtcacaaaaaccggagaactcttaagtagatta
tccgaagacacccagatcataaaaaacgctgctactacaaatctttctgaagctcttcgt
aacgtaacaactgcgcttataggagttggtttcatgtttacatcatcttggaaattaaca
ttgttggcgttagtagtagttccggtaatttcagttgctgtgaaacagtttggtcgctat
ctacgtgaactttcacacacaactcaagctgcagctgctgttgctgcatcaattgctgag
gaatcttttggtgcagtccgaactgttagatcgtttgcgaaagaaagctatatggtatca
caatattccaagaaagtcgatgagactctgaagctaggactcaaacaagctgtacttgtc
gggttgttcttcggaggactaaacgcagctttcacattatctgttattacggttgttagt
tatggagcatacttaacaatatatggttccatgaccgttggagcactcacttccttcatt
ctttatagcctcacagttggttcatcggtatcttctttatcgagtttgtacacaactgca
atgaaagctgcaggcgctagtagacgagtttttcagatcttggaccgtgtttctagcatg
tcaagttcaggggataagtgtccagtcggtaatcctgatggagatgtggaattaaatgat
gtctggtttgcttatccttctcgtcctagtcacatgatactcaagggaatatcgttgagg
ttgacaccaggctcaaaagttgcactagtaggaccaagcggtggaggaaaaacgaccata
gctaatttgattgagagattctatgatcctctcaagggaaagattttgcttaatggagtt
tctttgatggaaatatcccatcaataccttcacaaacagatcagcattgtaagtcaggaa
ccaattcttttcaactgttcagtggaagagaacatcgcatatggatttgacggtgaagct
agttttaccgatatagaaaatgcagcgaaaatggcgaatgcacacgagttcattgaagcg
tttccggataagtacaacactgttgtaggagaacgtggattacggctctcaggaggacag
aagcaaaggattgcaatcgcgagggcgcttcttacaaacccgagtgttttgctccttgat
gaagccacgagtgcactcgacgctgaaagcgaatatcttgttcaggatgcgatggactcg
ttaatggcgggaagaacggtgttggtgatagctcataggttatcgacggtcaagactgca
gactgtgtggcggttatatcagatggtgaggtggctgagaaaggcactcatgatgagctt
ctcagccttaatggaatctacacaaatcttgtcaagaggcagcttcagagttcttcctct
gttaccaccttgtga

DBGET integrated database retrieval system