KEGG   Arabidopsis thaliana (thale cress): AT5G41280Help
Entry
AT5G41280         CDS       T00041                                 

Definition
(RefSeq) Receptor-like protein kinase-related family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Stress-antifung
Motif
Other DBs
NCBI-GeneID: 834129
NCBI-ProteinID: NP_198944
MIPS: AT5G41280.1
TAIR: AT5G41280
Araport: AT5G41280
UniProt: Q9FHD5 A0A178UH46
Position
5
AA seq 286 aa AA seqDB search
METTKKLSVLLCLFFTMNQAISESDSDEHMATFCNDSSGNFTRNTTYNTNLNTLLSTLSN
QSSFANYYNLTTGLGSDTVHGMFLCIGDVNRTTCNACVKNATIEIAKNCTNHREAIIYYF
SCMVRYSDKFFLSTLETKPNTYWSSDDPIPKSYDKFGQRLSDKMGEVIIRSSLLSSSFTP
YYLMDTTTFDNLYDLESVVQCSPHLDPKNCTTCLKLALQELTQCCGDQLWAFIFTPKCLV
SFDTSNSSSLPPLPPPSRSGSFSIRGNNKILVGMILAVSVFAFLGL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacaaagaaactctctgttcttctctgtctcttcttcaccatgaaccaagct
atctccgaatccgattctgacgagcacatggcgactttttgcaatgattcatccggaaat
ttcactcgcaatacaacttacaacacaaatctcaacactcttctctccactcttagcaac
caatcatcattcgctaactactacaatctcacgaccggtttaggttcagacacagtccat
ggaatgttcttatgcataggagatgtcaacagaacaacatgcaacgcctgcgtcaagaac
gcaacaatcgagattgccaaaaactgtactaaccatcgagaagcaatcatttactacttc
tcttgtatggttcgctactcagataagttcttcctctccaccttagagacaaagcctaat
acttattggtcgtctgatgatccaatacccaaatcatatgataaatttggacagagactg
tctgacaaaatgggagaagttatcatcagatcatctttgttatcttcttcgtttacgcca
tattatcttatggataccactacgttcgataacttgtatgatctagagtctgttgttcag
tgtagtcctcatttggatccaaaaaactgcactacatgtctgaaacttgcgttgcaagaa
ctcactcaatgctgtggtgatcagctttgggctttcatcttcactcccaaatgtttagtg
agttttgatacctcaaattcatcgtcattgccaccgcttccaccgccaagtcgcagcggt
tccttctccattagaggaaataacaaaatacttgtgggaatgattcttgctgtttcggtg
tttgcatttttgggtttatga

DBGET integrated database retrieval system