KEGG   Arabidopsis thaliana (thale cress): AT5G41410Help
Entry
AT5G41410         CDS       T00041                                 

Gene name
BEL1
Definition
(RefSeq) POX (plant homeobox) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: POX Homeobox_KN Homeodomain Homez
Motif
Other DBs
NCBI-GeneID: 834143
NCBI-ProteinID: NP_198957
MIPS: AT5G41410.1
TAIR: AT5G41410
Araport: AT5G41410
UniProt: Q38897
Position
5
AA seq 611 aa AA seqDB search
MARDQFYGHNNHHHQEQQHQMINQIQGFDETNQNPTDHHHYNHQIFGSNSNMGMMIDFSK
QQQIRMTSGSDHHHHHHQTSGGTDQNQLLEDSSSAMRLCNVNNDFPSEVNDERPPQRPSQ
GLSLSLSSSNPTSISLQSFELRPQQQQQQGYSGNKSTQHQNLQHTQMMMMMMNSHHQNNN
NNNHQHHNHHQFQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWD
TSHHSNNDQHDQSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRV
AAAAFEAAVGLGGAEIYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDNRAVSIA
ARGETPRLRLLDQALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPS
DVDKHILARQTGLSRSQVSNWFINARVRLWKPMIEEMYCEETRSEQMEITNPMMIDTKPD
PDQLIRVEPESLSSIVTNPTSKSGHNSTHGTMSLGSTFDFSLYGNQAVTYAGEGGPRGDV
SLTLGLQRNDGNGGVSLALSPVTAQGGQLFYGRDHIEEGPVQYSASMLDDDQVQNLPYRN
LMGAQLLHDIV
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagatcagttctatggtcacaataaccatcatcatcaagagcaacaacatcaa
atgattaatcagatccaagggtttgatgagacaaaccaaaacccaaccgatcatcatcat
tacaatcatcagatctttggctcaaactccaacatgggtatgatgatagacttctctaag
caacaacagattaggatgacaagtggttcggatcatcatcatcatcatcatcagacaagt
ggtggtactgatcagaatcagcttctggaagattcttcatctgccatgagactatgcaat
gttaataatgatttcccaagtgaagtaaatgatgagagaccaccacaaagaccaagccaa
ggtctttccctttctctctcctcttcaaatcctacaagcatcagtctccaatctttcgaa
ctcagaccccaacaacaacaacaacaagggtattccggtaataaatcaacacaacatcag
aatctccaacacacgcagatgatgatgatgatgatgaatagtcaccaccaaaacaacaac
aataacaatcatcagcatcataatcatcatcagtttcagattgggagttccaagtatttg
agtccagctcaagagctactgagtgagttttgcagtcttggagtaaaggaaagcgatgaa
gaagtgatgatgatgaagcataagaagaagcaaaagggtaaacaacaagaagagtgggac
acaagtcaccacagcaacaatgatcaacatgaccaatctgcgactacttcttcaaagaaa
catgttccaccacttcactctcttgagttcatggaacttcagaaaagaaaagccaagttg
ctctccatgctcgaagagcttaaaagaagatatggacattaccgagagcaaatgagagtt
gcggcggcagcctttgaagcggcggttggactaggaggggcagagatatacactgcgtta
gcgtcaagggcaatgtcaagacactttcggtgtttaaaagacggacttgtgggacagatt
caagcaacaagtcaagctttgggagagagagaagaggataatcgtgcggtttctattgca
gcacgtggagaaactccacggttgagattgctcgatcaagctttgcggcaacagaaatcg
tatcgccaaatgactcttgttgacgctcatccttggcgtccacaacgcggcttgcctgaa
cgcgcagtcacaacgttgagagcttggctctttgaacactttcttcacccatatccgagc
gatgttgataagcatatattggcccgacaaactggtttatcaagaagtcaggtatcaaat
tggtttattaatgcaagagttaggctatggaaaccaatgattgaagaaatgtactgtgaa
gaaacaagaagtgaacaaatggagattacaaacccgatgatgatcgatactaaaccggac
ccggaccagttgatccgtgtcgaaccggaatctttatcctcaatagtgacaaaccctaca
tccaaatccggtcacaactcaacccatggaacgatgtcgttagggtcaacgtttgacttt
tccttgtacggtaaccaagctgtgacatacgctggtgaaggagggccacgtggtgacgtt
tccttgacgcttgggttacaacgtaacgatggtaacggtggtgtgagtttagcgttgtct
ccagtgacggctcaaggtggccaacttttctacggtagagaccacattgaagaaggaccg
gttcaatattcagcgtcgatgttagatgatgatcaagttcagaatttgccttataggaat
ttgatgggagctcaattacttcatgatattgtttga

DBGET integrated database retrieval system