KEGG   Arabidopsis thaliana (thale cress): AT5G41670
Entry
AT5G41670         CDS       T00041                                 
Name
(RefSeq) 6-phosphogluconate dehydrogenase family protein
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00030  Pentose phosphate pathway
ath00480  Glutathione metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ath_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT5G41670
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT5G41670
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     AT5G41670
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     AT5G41670
SSDB
Motif
Pfam: 6PGD NAD_binding_2
Other DBs
NCBI-GeneID: 834169
NCBI-ProteinID: NP_001332670
TAIR: AT5G41670
UniProt: Q9FFR3 A0A178UQL8
Position
5:complement(16664674..16667390)
AA seq 487 aa
MESVALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASNEGKLPVAGQ
YSPRDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVE
AEKKGLLYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFTEWNRGELESFLVEIT
SDIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLEEAGLKEDIGSASRGVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEK
GWDLNLGEMARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRV
VGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT
KLARKSQ
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagtccgtcgctctatctcgcataggtctcgccggtctcgcagtcatgggacaaaac
ctcgccttaaacatcgccgataaaggattcccaatctccgtctacaatcgaaccacttcc
aaagtcgacgaaaccttagatcgtgcctccaacgaaggaaaactcccagtcgctggtcaa
tactcgcctcgcgatttcgttctctcgatccaacggcctagatccgttatcatccttgtc
aaagccggtgctcccgttgaccaaaccatctctgctctctctgaatacatggagcctggt
gattgtatcatcgacggtggaaatgagtggtatcagaacacagagcgacgaatcgttgaa
gctgagaagaaaggattgctttatttaggtatgggagtctccggtggtgaagaaggagct
cgtaatggtccttctcttatgcctggtggatctttcactgcgtataacaatgttaaagat
attcttgagaaagttgctgctcaagtcgaagatggtccttgtgttacatacattggagaa
ggtggatctgggaattttgtgaaaatggttcataatgggattgaatatggtgatatgcag
ctgatttcggaggcgtatgacgtgttgaagaacgttggtggattgagtaatgatgaattg
gctgagatcttcacggagtggaatcgaggtgagcttgagagtttcttggttgagattact
tcggatatatttagggttaaggatgattatggtgatggagagttagtggataagattttg
gataagactggtatgaaaggtacagggaaatggacggttcagcaggcggctgagctttct
gttgcggcgcctacgattgctgcgtcgttggattgtagatacttgagtggattgaaggat
gagagggagaatgctgctaaagttttggaagaagctggattgaaggaggatatcggttct
gcgtctcgtggtgttgataagaagaggttgattgatgatgtgaggcaagctttgtatgct
tctaagatctgtagttatgctcaagggatgaatttgcttagggctaagagtttagagaaa
ggttgggacttgaatttgggtgaaatggctaggatttggaaaggtgggtgtattatcagg
gcggttttcttggacaggatcaagaaagcttaccagagaaacccgaatttggcgagctta
gtggttgatcctgattttgctaaagagatggttcagaggcaagctgcatggaggagagtg
gtgggtcttgctatatctgctgggattagcacaccaggaatgtgcgcaagtttagcgtat
ttcgacacttacaggcgtgctagattacctgcgaatctggttcaggcgcagagagatctc
tttggagctcatacatatgagagaaccgatcgtcctggtgcataccacactgaatggact
aagcttgcaaggaagagtcagtaa

DBGET integrated database retrieval system