KEGG   Arabidopsis thaliana (thale cress): AT5G42450Help
Entry
AT5G42450         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 TPR_17
Motif
Other DBs
NCBI-GeneID: 834252
NCBI-ProteinID: NP_199060
MIPS: AT5G42450.1
TAIR: AT5G42450
Araport: AT5G42450
UniProt: Q9FIH2
Position
5
AA seq 517 aa AA seqDB search
MLHMILSQRVILLRKYHSSANALVTKSPNSIPELVKHIDSDLIRNAHKVFDEIPELDVIS
ATAVIGRFVKESRHVEASQAFKRLLCLGIRPNEFTFGTVIGSSTTSRDVKLGKQLHCYAL
KMGLASNVFVGSAVLNCYVKLSTLTDARRCFDDTRDPNVVSITNLISGYLKKHEFEEALS
LFRAMPERSVVTWNAVIGGFSQTGRNEEAVNTFVDMLREGVVIPNESTFPCAITAISNIA
SHGAGKSIHACAIKFLGKRFNVFVWNSLISFYSKCGNMEDSLLAFNKLEEEQRNIVSWNS
MIWGYAHNGRGEEAVAMFEKMVKDTNLRPNNVTILGVLFACNHAGLIQEGYMYFNKAVND
YDDPNLLELEHYACMVDMLSRSGRFKEAEELIKSMPLDPGIGFWKALLGGCQIHSNKRLA
KLAASKILELDPRDVSSYVMLSNAYSAMENWQNVSLIRRKMKETGLKRFTGCSWIEVRDQ
IRVFVNADKNNELKDEVYRMLALVSQHLEENECWKDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatatgattttatctcaaagagtaatccttttacgaaaatatcactcttctgca
aatgcccttgttaccaaatcaccaaattctatccccgagttggttaaacatattgattcg
gatctgatacgtaatgcacataaggtgttcgacgaaattcctgagttagatgtcatttct
gctacagcggtgattggtcgctttgtgaaggaaagcagacatgtggaagcaagtcaagcc
ttcaaaaggttgttgtgtttaggcataaggccaaatgagttcacgtttggcacggtcatt
gggtcttctacaacttcgagagatgtcaaattgggtaagcagcttcattgttatgcgtta
aagatgggacttgcgtcgaatgtgtttgttggtagtgcggttttgaactgttatgtgaaa
ctgagtacgttgacagatgctcgtagatgttttgatgacactagagacccaaacgtagtt
tctattaccaatttgattagtgggtaccttaagaaacatgaatttgaagaagctctttcg
ttgtttagagcaatgcctgagagaagtgttgttacttggaatgcagttattggagggttt
agccagacggggcggaacgaagaggctgtgaatacttttgtggatatgttaagggaaggt
gtggtgatacctaacgaatcaaccttcccttgtgctataacagccatatctaatatagct
tctcatggtgctggtaagagtattcacgcctgcgctataaagttcttggggaagcgattc
aatgtctttgtttggaactctctgatcagtttttactcaaaatgtgggaacatggaagat
agtcttctggctttcaacaagctcgaagaagaacaacggaacattgtatcttggaactct
atgatatggggttatgcgcacaacggaagaggagaagaagctgtagccatgtttgagaaa
atggttaaagacacaaacctgagaccaaacaacgtgacaatccttggagtattatttgcg
tgtaaccatgcgggcctaatacaagaagggtacatgtattttaacaaagctgtgaatgat
tatgatgatccaaacctactagaactggagcactatgcttgtatggtggatatgctttct
aggtccggccgtttcaaagaagcagaagagcttattaaaagtatgcctcttgacccagga
atcgggttttggaaggcattgcttgggggatgccagattcactcaaacaagcgtctggct
aaattagcggcgtcaaaaatcttggaattggatcctagagatgtttcatcatacgtaatg
ctttcaaatgcttattctgctatggaaaactggcagaatgtgtcgctgatacggaggaaa
atgaaggagactggtttaaagcgttttacgggatgtagttggattgaagttagagaccaa
attcgtgtctttgtgaatgctgacaagaacaacgaacttaaggatgaagtctataggatg
ttggcacttgtttctcaacatcttgaagaaaatgaatgttggaaagacttgtga

DBGET integrated database retrieval system