KEGG   Arabidopsis thaliana (thale cress): AT5G42630Help
Entry
AT5G42630         CDS       T00041                                 

Gene name
ATS
Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding CPSF100_C
Motif
Other DBs
NCBI-GeneID: 834270
NCBI-ProteinID: NP_199077
MIPS: AT5G42630.1
TAIR: AT5G42630
Araport: AT5G42630
UniProt: Q9FJV5
Position
5
AA seq 276 aa AA seqDB search
MMMLESRNSMRASNSVPDLSLQISLPNYHAGKPLHGGDRSSTSSDSGSSLSDLSHENNFF
NKPLLSLGFDHHHQRRSNMFQPQIYGRDFKRSSSSMVGLKRSIRAPRMRWTSTLHAHFVH
AVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVKCTDKGSPGEGKVEKEAEQR
IEDNNNNEEADEGTDTNSPNSSSVQKTQRASWSSTKEVSRSISTQAYSHLGTTHHTKDNE
EKEDTNIHLNLDFTLGRPSWGMEYAEPSSDLTLLKC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgttagagtcaagaaacagtatgagagcttcaaactcagtcccagatctgtct
cttcagatcagtcttcctaactatcacgccggaaaacctcttcacggcggtgaccggagc
tccacaagcagtgattctggaagcagcctcagtgacctgagccatgagaacaacttcttc
aacaaacctctcttgagcttaggatttgaccatcatcatcaaaggcgctcaaacatgttc
caacctcaaatctacggtcgagatttcaagagaagctcatcatcaatggttggtcttaaa
cgaagcattcgtgctccaagaatgagatggacttctactcttcatgctcacttcgtccat
gctgttcaacttcttggcggccatgaaagagcaacgcctaaatcagtgttggagctcatg
aatgtgaaggatctaaccctagctcatgtcaagagtcacttgcagatgtatagaacagtg
aaatgcactgataaaggatcaccaggagaaggaaaggtagagaaagaggcagagcagagg
atagaggacaataataataatgaagaagctgatgaaggaactgacacaaattcgccaaac
tcatcatctgtgcaaaagacccaaagagcttcatggtcatcgacaaaggaagtatctagg
agcatatctacacaagcatattctcacttgggaacaactcatcacactaaggacaatgaa
gagaaagaggataccaacattcatctcaatttggatttcacattggggcggcctagttgg
gggatggaatatgcggaaccctccagtgatttaacccttctcaagtgctaa

DBGET integrated database retrieval system