KEGG   Arabidopsis thaliana (thale cress): AT5G44080Help
Entry
AT5G44080         CDS       T00041                                 

Definition
(RefSeq) Basic-leucine zipper (bZIP) transcription factor family protein
  KO
K14432  ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT5G44080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT5G44080
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT5G44080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 834431
NCBI-ProteinID: NP_199221
MIPS: AT5G44080.1
TAIR: AT5G44080
Araport: AT5G44080
UniProt: Q9FNB9
Position
5
AA seq 315 aa AA seqDB search
MTSFQVMRSSNSRNSDLSRRISSASTSSSSIRPQQQFRRDLTSVGYGGRNDGLYSSNSMT
VEGILHDTFASDPPAPTESSLLDASINLMDASPAPMEITTTTASDVVDHGGGTETTRGGK
SVDEIWREMVSGEGKGMKEETSEEIMTLEDFLAKAAVEDETAVTASAEDLDVKIPVTNYG
FDHSAPPHNPFQMIDKVEGSIVAFGNGLDVYGGGARGKRARVMVEPLDKAAAQRQRRMIK
NRESAARSRERKQAYQVELEALAAKLEEENELLSKEIEDKRKERYQKLMEFVIPVVEKPK
QQPPRFLRRIRSLEW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgtttcaggtgatgcgttcttcaaattcgagaaactcggatctatctcgtcgc
atctcttctgcttctacttcttcttcgtctataagacctcaacaacagttccggcgagat
ctaacaagtgtcggttacggcggaagaaacgacggattatacagttcaaattcgatgacg
gtcgaagggattttacacgatactttcgcatcagatccaccagcaccaacggaatcttca
ctcttagatgcgtcgataaatctgatggatgcttctccagcaccaatggagataacaaca
acgacggcttctgatgttgtggatcacggcggaggaacggagacgacgcgtggtgggaag
agtgttgatgagatttggagagagatggtatcaggagaaggtaaagggatgaaggaagag
acgtcggaagagataatgacgttagaggattttctagcgaaagctgcggtggaagacgaa
acagcggtgacggcgtcggcggaggatttggatgtgaagattccggtgacgaattacgga
ttcgatcattctgcaccgccgcataatccgtttcagatgattgataaagtagaaggatca
atagttgcgtttgggaatggtttagatgtttacggaggaggagctagagggaagagagcg
agagtgatggttgagccattggataaagcagctgcacagagacagagaaggatgattaag
aatcgtgaatctgcagctaggtctagagagaggaaacaagcttatcaagttgagttagaa
gctttggctgcgaagcttgaggaagagaatgagttgctttctaaggagattgaagataag
aggaaagagagataccagaagttgatggagtttgtgattcctgttgttgagaaaccgaag
cagcagccaccacggtttttacgcaggattcggtctttggaatggtga

DBGET integrated database retrieval system