KEGG   Arabidopsis thaliana (thale cress): AT5G44180
Entry
AT5G44180         CDS       T00041                                 
Symbol
RLT2
Name
(RefSeq) Homeodomain-like transcriptional regulator
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: WSD DDT HARE-HTH Homeodomain WHIM1 Homeobox_KN
Other DBs
NCBI-GeneID: 834441
NCBI-ProteinID: NP_001318738
TAIR: AT5G44180
UniProt: Q9FFH1
Position
5:17782428..17790234
AA seq 1694 aa
MEGGSEKTTPEGCGGESKSKRKMKTAAQLEVLENTYSAEPYPSEAIRADLSVKLNLSDRQ
LQMWFCHRRLKERKSTTPSKRQRKELVTPTAMESWEPPVNAGDLVAGNELDSRRAARGSG
GSGVTVVRRFNEPSSAEVRAIGYVEAQLGERLRDNGPVLGMEFDPLPPGAFGMPIEMPSH
RKATRQAFETNIYVRSDVKPIKDHVRPIREYQFIPELPSSRTDHSERVSPSHHFGVPLDG
SVMRVSAVSAGHRDDYKISPQIPNLNLATHQGKPGHVYSPNLVEYDSPYQKSYMDTAAQV
HDDPFVKSEREVGNEDEDDDALQLERHRKNEEARIAREVEAHEKRIRRELEKQDMLRRKR
EEQIRKEMERQDRERRKEEERLLREKQREEERYLKEQMRELQRREKFLKKETIRAEKMRQ
KEEMRKEKEVARLKAANERAIARKIAKESMELIEDERLELMEVAALTKGLPSMLALDFET
LQNLDEYRDKQAIFPPTSVKLKKPFAVKPWNGSDENVANLLMVWRFLITFADVLGLWPFT
LDEFAQAFHDYDPRLMGEIHIVLLKTIIKDIEGVVRTLSTGVGANQNVAANPGGGHPHVV
EGAYAWGFDIRSWRKNLNVFTWPEILRQLALSAGLGPQLKKMNIRTVSVHDDNEANNSEN
VIFNLRKGVAAENAFAKMQERGLSNPRRSRHRLTPGTVKFAAFHVLSLEGEKGLNILEVA
EKIQKSGLRDLTTSRTPEASVAAALSRDTKLFERVAPSTYCVRASYRKDAGDAETIFAEA
RERIRAFKSGITDVEDVDDAERDEDSESDVGEDPEVDVNLKKEDPNPLKVENLIGVEPLL
ENGKLDTVPMKTELGLPLTPSLPEEMKDEKRDDTLADQSLEDAVANGEDSACFDESKLGE
QWVQGLVEGDYSNLSSEERLNALVALIGIATEGNTIRIALEERLEVASALKKQMWGEVQL
DKRWKEESLIRANYLSYPTAKPGLNIATPASGNQESSSADVTPISSQDPVSLPQIDVNNV
IAGPSLQLQENVPGVENLQYQQQQGYTADRERLRAQLKAYVGYKAEELYVYRSLPLGQDR
RRNRYWRFSASASRNDPGCGRIFVELQDGRWRLIDSEEAFDYLVKSLDVRGVRESHLHFM
LLKIEASFKEALRRNVAANPGVCSISSSLDSDTAEISTTFKIELGDSNAVERCSVLQRFH
SFEKWMWDNMLHPSALSAFKYGAKQSSPLFRICRICAELHFVGDICCPSCGQMHAGPDVG
ELCFAEQVAQLGDNLRRGDTGFILRSSILSPLRIRLLKVQLALVEASLPPEGLEAFWTEN
LRKSWGMKLLSSSSHEDLYQVLTTLEAALKRDFLSSNFETTSELLGLQEGALASDLTCGV
NVLPWIPKTAGGVALRLFDFDSSIVYTPDQNNDPLKDKESEDFVGLETNILRNLHEKDVM
ETPVQVAAYKQEENWTDPGLGGVSSSGRGGRPPRGRGRPRARGNGKKPAVSVKPPRGAAN
SNGETMLRPRAQPRGGRKNGRRSGTKGRKRPTQGTLGICNEVGGGRRVKEVAVTAKTSLP
DNDDDWIETPELQDDDGEASSSGRSFQYEDYDDDDVMAPIDDFDGGGESSKLVGRGEFSL
HSDDEYEEEEEEEEDMNMKMDVNVVDDEDEDYINEDSYGRKQHGISISNDAATRKRFNKF
EDPDLTSSSSSDFQ
NT seq 5085 nt   +upstreamnt  +downstreamnt
atggaaggtgggtctgaaaaaacaacacctgaaggttgtggtggtgagagtaagtctaaa
cggaaaatgaaaactgctgctcaacttgaagttcttgaaaacacttattcagctgagcct
tatccttcggaagctataagagcggatctctcagtgaaactgaatctttccgatagacag
ttacagatgtggttttgtcaccggcggcttaaagaacggaaatctactacgccgagcaaa
cgtcagcgtaaggagttagtaactccaacggctatggaatcctgggaaccacccgtcaat
gccggtgatttagtggcgggaaatgagcttgattctagaagagctgctcgaggcagtggc
ggtagtggtgtgacggttgtgaggcggtttaatgaaccgtcttctgctgaggttagagct
attggttatgttgaagctcaattgggagagcggttgagagataacggaccggttcttgga
atggagtttgatcctttacctcctggtgcatttggcatgcctattgagatgccaagccat
cgcaaggcgactaggcaagctttcgagaccaacatatatgtccgatccgatgtcaagcct
atcaaagatcatgtgaggcctattcgtgaatatcagttcattcctgagctgccatcttcg
aggactgatcattcggaacgagtttctccgtcacatcattttggagttccacttgatggt
tcggttatgagggtttcagctgtgtctgctggacatcgggatgactataaaatttcacct
cagataccaaatttgaatcttgcaactcatcaagggaagccggggcatgtctattcgcct
aacttggtcgaatatgactcaccgtatcagaaaagctacatggatactgctgcacaagtt
catgatgatccttttgtgaaatcagagagagaagttggtaatgaggatgaggatgatgat
gccctgcaattagagagacaccgcaagaatgaagaagcaagaatagctcgggaagtcgag
gctcatgagaagaggatccgaagggaactagagaaacaagatatgctgaggcgaaagaga
gaagagcaaataaggaaagaaatggagaggcaagatcgtgaaagacggaaagaggaagaa
cgtcttttacgtgaaaaacagagagaggaagagaggtaccttaaagagcagatgcgagag
ttgcagcgaagagagaagttcttgaagaaagaaacaatcagggctgagaaaatgcgacaa
aaagaagagatgcgtaaagaaaaagaggttgccaggcttaaagctgctaatgagagggcc
attgctcgtaagatcgcaaaggaatctatggaacttattgaagatgaacgcttagagctc
atggaggttgctgcgttaacaaaaggcttgccttcaatgctcgcccttgactttgaaact
ctacagaacctcgatgaatatagagacaagcaggcaatatttcccccaacatctgtaaaa
ttgaaaaagccctttgcagtcaagccgtggaatggttctgatgagaatgttgcaaatctt
cttatggtgtggagattcttaatcactttcgcagacgttcttggtctttggccatttacc
ctggacgagtttgctcaggcattccatgactatgacccacggctaatgggagagatacac
attgttctattgaagactataatcaaagatatcgagggtgtggtaagaacgctgtcgacc
ggtgttggagcaaaccagaatgttgctgctaatcccggagggggtcatcctcacgttgtg
gagggtgcatacgcgtggggttttgatatacgcagctggagaaaaaacttgaatgttttt
acatggcctgaaatcttgaggcaactcgctctctctgccgggttgggaccgcaactgaag
aaaatgaacattaggactgtgtctgttcatgatgacaatgaggccaacaactctgagaat
gtgattttcaacctaaggaaaggagtagcagctgagaatgcttttgccaagatgcaagag
aggggactttctaatccacgacgttcacggcatcgtttgactccaggcactgttaagttt
gctgcatttcatgttctatctcttgaaggtgaaaaaggtttgaacattcttgaggttgca
gagaagattcagaaatcaggattgagggatctaacgacgagtaggacacctgaagcctcg
gttgctgctgcgttgtctcgagatacaaaactctttgagagggtagctccttctacgtat
tgtgtacgtgcttcctatagaaaagatgcaggtgatgctgagactatatttgctgaagcg
agagagagaatacgtgcattcaagagcggcatcactgatgtagaagatgttgatgacgct
gagagagatgaagactctgaaagcgatgtcggagaagacccagaggttgatgtgaacctt
aaaaaggaagatcccaatcctctgaaggtagaaaacttaattggagtcgaaccattgttg
gaaaatgggaaactggataccgtgcccatgaaaactgaactgggactgcctcttactccc
tctctccccgaggaaatgaaagatgagaaaagagatgacactttagcggaccaatctcta
gaggatgcggtagcaaacggtgaagatagtgcttgttttgacgagagcaaacttggggaa
cagtgggttcaaggacttgtagaaggagattactcgaatcttagcagcgaggaacgttta
aacgcacttgttgctctgattggtattgccaccgaaggaaacacaatccgaatcgccctt
gaggaacggttggaggtagcaagtgcattaaagaaacagatgtggggtgaagtgcaactc
gacaaacgctggaaagaagagtctttgattcgagcaaattacctctcatacccaacagca
aagccggggcttaatatcgcaacccctgcatctggaaatcaagaaagttcatcagcggat
gtgactccaatctcctcacaggacccggtgagtcttccacagatcgatgtgaataacgtg
attgctggaccaagcttgcaattgcaagaaaatgtacctggagtggagaatttgcagtat
cagcagcaacaggggtacacagcggaccgggaaaggctgcgtgcacagttaaaagcgtat
gttgggtataaagctgaagagctatatgtatataggtcgcttccgctaggtcaagatcga
agacgcaatcgctattggcggttttcagcatccgcctctcgaaatgatcctggttgtggt
agaatattcgtggaacttcaggacggacgctggaggctcattgattccgaagaggctttt
gactatttggtgaagtcactagatgttcgcggtgtaagagaatcacatttacactttatg
ttgctgaagatcgaagcatccttcaaggaagcattaaggaggaatgtggcagcaaatccc
ggggtgtgttccatatcttctagcttggattccgatactgcggaaatctccacgacgttt
aagatcgagctaggggatagtaacgccgttgagagatgcagcgtattgcaacgcttccat
agtttcgagaagtggatgtgggataatatgctgcatcctagtgctttatctgcatttaag
tatggtgctaagcaaagcagtccgctttttcgcatatgcagaatctgtgcggaactacac
tttgtcggagatatttgctgtcctagttgcggtcagatgcatgctggtccagatgttggt
gagttgtgttttgctgagcaagtggctcaactcggggataatttgagaagaggagatact
ggctttatcttgcgtagctcaatcttgtctcctcttagaataagactactcaaggttcag
ttagcacttgtcgaagcttctcttccacctgaaggacttgaagctttttggacagagaat
cttaggaaatcttggggtatgaagctgttgtcatcaagttcccatgaagatctttatcag
gttctcacaacgttagaggcagcactaaagagggatttcttgtcttcaaactttgaaaca
acttctgaactcttgggtttacaagaaggagctctcgccagcgatcttacttgtggggtt
aatgtactaccgtggataccaaagacagcaggaggtgtagctttgagactctttgatttc
gacagctcgattgtttacacacccgatcaaaacaacgatcctctaaaagacaaagaatct
gaagatttcgtgggtttggagacaaatattctgagaaacttacatgagaaggacgtaatg
gaaactccggtgcaagttgctgcttataagcaagaagagaactggacggatcctggttta
ggtggtgtgtctagctctgggagaggaggtcgaccaccacgaggacgtggccggcctcgt
gcccgtggcaatggcaagaaaccggcagtttctgttaaaccaccacgaggtgcagcaaac
tcaaatggtgaaaccatgttgagaccgagagcacaaccacgtgggggtagaaagaatggg
cggcgtagtggcaccaaaggccgaaagagaccaacgcaaggaacactcggtatatgtaat
gaagtaggaggaggacgtcgggttaaggaagttgctgtaaccgccaaaaccagtcttcct
gataacgatgacgattggatcgaaacccctgaactgcaagacgatgacggagaagctagc
agctcggggagatcgtttcagtatgaggactatgatgatgatgatgtcatggctccgatt
gatgattttgatggcggcggcgaatcaagtaaattagtaggtaggggggaatttagctta
catagtgatgatgaatacgaagaagaagaggaagaagaagaagacatgaacatgaaaatg
gatgtgaatgttgttgatgatgaggatgaagattacataaacgaagactcgtatggtaga
aagcagcatgggattagcattagcaacgatgcagcgactcggaaaaggtttaataagttt
gaagatcctgatctaacatcttcatcgtcttctgattttcaatga

DBGET integrated database retrieval system