KEGG   Arabidopsis thaliana (thale cress): AT5G44190Help
Entry
AT5G44190         CDS       T00041                                 

Gene name
GLK2
Definition
(RefSeq) GOLDEN2-like 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding PHD20L1_u1
Motif
Other DBs
NCBI-GeneID: 834442
NCBI-ProteinID: NP_199232
MIPS: AT5G44190.1
TAIR: AT5G44190
Araport: AT5G44190
UniProt: Q9FFH0
Position
5
AA seq 386 aa AA seqDB search
MLTVSPAPVLIGNNSKDTYMAADFADFTTEDLPDFTTVGDFSDDLLDGIDYYDDLFIGFD
GDDVLPDLEIDSEILGEYSGSGRDEEQEMEGNTSTASETSERDVGVCKQEGGGGGDGGFR
DKTVRRGKRKGKKSKDCLSDENDIKKKPKVDWTPELHRKFVQAVEQLGVDKAVPSRILEI
MNVKSLTRHNVASHLQKYRSHRKHLLAREAEAASWNLRRHATVAVPGVGGGGKKPWTAPA
LGYPPHVAPMHHGHFRPLHVWGHPTWPKHKPNTPASAHRTYPMPAIAAAPASWPGHPPYW
HQQPLYPQGYGMASSNHSSIGVPTRQLGPTNPPIDIHPSNESIDAAIGDVISKPWLPLPL
GLKPPSVDGVMTELQRQGVSNVPPLP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttaactgtttctccggctccagtactcatcggaaacaactcaaaggatacttacatg
gcggcagatttcgcagattttacgacggaagacttgccggactttacgacggtcggggat
ttttccgatgatcttcttgatggaatcgattactacgacgatcttttcattggtttcgat
ggagacgatgttttgccggatttggagatagattcggagattcttggggaatattccggt
agcggaagagatgaggaacaagaaatggagggtaacacttcgacggcatcggagacatcg
gagagagacgttggtgtgtgtaagcaagagggtggtggtggtggtgacggtggttttagg
gacaaaacggtgcgtcgaggcaaacgtaaagggaagaaaagtaaagattgtttatccgat
gagaacgatattaagaaaaaacctaaggtggattggacgccggagttacaccggaaattt
gtacaagcggtggagcaattaggggtagacaaggcggtgccgtctcgaatcttggaaatt
atgaacgttaaatctctcactcgtcacaacgttgctagccatcttcagaaatataggtca
catcggaaacatctactagcgcgtgaagcagaagctgccagctggaatctccggagacat
gccacggtggcagtgcccggagtaggaggaggagggaagaagccgtggacagctcctgcc
ttaggctatcctccacacgtggcaccaatgcatcatggtcacttcaggcctttgcacgta
tggggtcatcctacgtggccaaaacacaagcctaatactccggcgtctgctcatcggacg
tatccaatgccggccattgcggcggctccggcatcttggccaggtcatccaccgtactgg
catcagcaaccactctatccacagggatatggtatggcatcatcgaatcattcaagcatc
ggtgttcccacaagacaattaggacccactaatcctcccatcgacattcatccctcgaat
gagagcatagatgcagctattggggacgttatatcaaagccgtggctgccgcttcctttg
ggactgaaaccgccgtcggttgacggtgttatgacggagttacaacgtcaaggagtttct
aatgttcctcctcttccttga

DBGET integrated database retrieval system