KEGG   Arabidopsis thaliana (thale cress): AT5G45050
Entry
AT5G45050         CDS       T00041                                 
Symbol
TTR1
Name
(RefSeq) Disease resistance protein (TIR-NBS-LRR class)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: WRKY NB-ARC LRR_3 TIR LRR_4 AAA_16 AAA nSTAND3 AAA_22 NACHT ATPase_2
Other DBs
NCBI-GeneID: 834536
NCBI-ProteinID: NP_851133
TAIR: AT5G45050
UniProt: Q9FL92
Position
5:complement(18176894..18181973)
AA seq 1372 aa
MTESEQIVYISCIEEVRYSFVSHLSKALQRKGVNDVFIDSDDSLSNESQSMVERARVSVM
ILPGNRTVSLDKLVKVLDCQKNKDQVVVPVLYGVRSSETEWLSALDSKGFSSVHHSRKEC
SDSQLVKETVRDVYEKLFYMERIGIYSKLLEIEKMINKQPLDIRCVGIWGMPGIGKTTLA
KAVFDQMSGEFDAHCFIEDYTKAIQEKGVYCLLEEQFLKENAGASGTVTKLSLLRDRLNN
KRVLVVLDDVRSPLVVESFLGGFDWFGPKSLIIITSKDKSVFRLCRVNQIYEVQGLNEKE
ALQLFSLCASIDDMAEQNLHEVSMKVIKYANGHPLALNLYGRELMGKKRPPEMEIAFLKL
KECPPAIFVDAIKSSYDTLNDREKNIFLDIACFFQGENVDYVMQLLEGCGFFPHVGIDVL
VEKSLVTISENRVRMHNLIQDVGRQIINRETRQTKRRSRLWEPCSIKYLLEDKEQNENEE
QKTTFERAQVPEEIEGMFLDTSNLSFDIKHVAFDNMLNLRLFKIYSSNPEVHHVNNFLKG
SLSSLPNVLRLLHWENYPLQFLPQNFDPIHLVEINMPYSQLKKLWGGTKDLEMLKTIRLC
HSQQLVDIDDLLKAQNLEVVDLQGCTRLQSFPATGQLLHLRVVNLSGCTEIKSFPEIPPN
IETLNLQGTGIIELPLSIVKPNYRELLNLLAEIPGLSGVSNLEQSDLKPLTSLMKISTSY
QNPGKLSCLELNDCSRLRSLPNMVNLELLKALDLSGCSELETIQGFPRNLKELYLVGTAV
RQVPQLPQSLEFFNAHGCVSLKSIRLDFKKLPVHYTFSNCFDLSPQVVNDFLVQAMANVI
AKHIPRERHVTGFSQKTVQRSSRDSQQELNKTLAFSFCAPSHANQNSKLDLQPGSSSMTR
LDPSWRNTLVGFAMLVQVAFSEGYCDDTDFGISCVCKWKNKEGHSHRREINLHCWALGKA
VERDHTFVFFDVNMRPDTDEGNDPDIWADLVVFEFFPVNKQRKPLNDSCTVTRCGVRLIT
AVNCNTSIENISPVLSLDPMEVSGNEDEEVLRVRYAGLQEIYKALFLYIAGLFNDEDVGL
VAPLIANIIDMDVSYGLKVLAYRSLIRVSSNGEIVMHYLLRQMGKEILHTESKKTDKLVD
NIQSSMIATKEIEITRSKSRRKNNKEKRVVCVVDRGSRSSDLWVWRKYGQKPIKSSPYPR
SYYRCASSKGCFARKQVERSRTDPNVSVITYISEHNHPFPTLRNTLAGSTRSSSSKCSDV
TTSASSTVSQDKEGPDKSHLPSSPASPPYAAMVVKEEDMEQWDNMEFDVDVEEDTFIPEL
FPEDTFADMDKLEENSQTMFLSRRSSGGNMEAQGKNSSDDREVNLPSKILNR
NT seq 4119 nt   +upstreamnt  +downstreamnt
atgaccgagagtgagcaaatcgtctacatcagctgcatagaggaggtacgatactccttc
gtcagccacctctccaaagctctccagcgaaaaggtgtaaacgatgtcttcatcgatagc
gatgattcgctttccaacgagtctcaatcaatggtcgagagagctagggtttctgttatg
attttaccaggaaaccgtacggtatctcttgacaagctcgtgaaggttctcgattgccag
aagaacaaagatcaagtggtggttccggtgttgtacggtgtcagatcatcagagaccgaa
tggcttagcgcgctggattcgaaaggattctcatcagtacaccattccaggaaagaatgt
agtgactcccagcttgtaaaagagactgttagagatgtgtatgagaagctcttttatatg
gaacgaattggaatatattcgaagctgctggagattgagaaaatgattaacaagcaaccg
ttggacatccgttgtgttggaatttggggtatgcctggcataggcaagactacacttgct
aaagcagtctttgaccaaatgtctggtgagtttgatgctcattgctttattgaagactac
accaaagctattcaagagaagggtgtttattgtttgctggaggaacagtttttgaaagaa
aatgctggtgctagtggtaccgttacgaaattgagcttgcttagggatagattaaacaat
aagagggttcttgttgttcttgatgatgtccgcagtcctctggttgtggagtcttttctt
ggagggtttgactggtttggtcccaaaagtctaatcatcataacctccaaagataaatcg
gtgtttcgcctttgtcgagtcaatcaaatatacgaggttcagggtttaaatgagaaagag
gctcttcaactcttctctttgtgtgcgtctatagacgatatggcagagcagaatctccac
gaggtgtcaatgaaagttattaaatatgctaatggccatccattagctctcaatctctat
ggcagagaactgatggggaagaaaagaccaccagaaatggagatagcattcctcaaactc
aaggaatgtcctccagctatttttgttgatgcaatcaagagctcgtatgacacactcaat
gacagggaaaaaaacatttttttggacatagcttgtttcttccagggagaaaatgttgac
tacgtgatgcaactgcttgagggttgtggtttctttccacatgttggaattgatgttctt
gtggagaagagtctggtgactatttcagaaaaccgagtgcggatgcataacttgatccaa
gatgttggccgacaaataataaatagagaaacaagacagactaagaggcgcagcagactg
tgggaaccttgcagcatcaaatatttattagaagataaggaacaaaacgaaaatgaagaa
caaaaaacaacttttgaacgtgctcaggtccctgaagagatcgaaggcatgtttctggac
acatcaaacttaagttttgatattaagcatgttgcctttgataatatgttgaaccttaga
ttgttcaagatttacagttccaatcctgaagtccatcatgtaaacaatttcctcaaaggc
tctctcagttctcttcctaatgtgctaagactcctgcattgggagaactatcctctgcag
tttctgcctcaaaattttgatcctatacaccttgttgaaatcaacatgccgtacagccaa
cttaagaaactttggggtggaaccaaggacctggagatgttgaagacaatcaggctttgt
cattcccaacaactagttgatattgacgatcttttaaaagctcaaaatcttgaggtagtt
gatctccaaggctgtacaagactgcagagtttcccagccaccggtcaattgctacattta
cgagttgtaaatctctcaggttgcacagagatcaaaagtttcccagaaattcccccaaat
attgagacactgaatctacaggggactggtataatagaattaccactttccattgttaag
ccaaactacagagagcttttgaatcttctagctgaaatcccgggtctttcaggtgtctca
aaccttgagcaaagtgatctcaaacctttaacaagcctgatgaaaattagcacatcttac
caaaatcctggcaagcttagttgcttggagctgaatgattgttctcgtttgcgaagtctg
ccaaacatggttaatttagaacttctcaaagcccttgatctttctggttgctcagagctc
gagactatccagggtttcccacggaacctgaaagagttatatcttgttggcactgcagta
agacaagtgccacaacttcctcaaagtctagaattctttaatgcccatggttgtgtctct
ctcaaatcaattcgtttggacttcaagaagcttcctgtgcattacacatttagtaattgt
ttcgatctatctccacaagtggtcaacgattttttagtgcaggcgatggctaatgtgatt
gcaaaacacataccaagagagcgtcatgtcacaggcttttctcaaaagactgtgcagcgt
tcgagtcgtgacagtcagcaggaactcaacaaaactttggctttcagcttctgtgcgccc
tcacatgcgaatcaaaattccaaacttgatctgcaaccaggatcttcttcaatgacacga
ctagatccttcttggaggaacacacttgtgggctttgctatgctggtgcaagtcgcattt
tccgagggttactgtgatgatactgattttggcattagttgtgtttgcaaatggaaaaac
aaggaaggccactctcataggagagaaataaatttgcattgttgggctttagggaaagct
gttgaaagggatcatacgtttgtcttctttgatgtcaacatgcgtccagataccgatgaa
ggaaatgaccccgatatctgggctgatttagttgtttttgagttctttcctgtcaataaa
cagagaaagcctctaaatgatagttgcacagtgacaagatgtggagtccgtttaataact
gctgtaaactgcaatacaagtatcgagaatatatcaccagttttgtccttggatccgatg
gaggtttctggtaatgaagatgaagaagtattgagagtcagatatgctggtttacaggag
atatataaagctttgtttctttacatagcgggtttgttcaatgacgaggatgttggtttg
gtagcaccacttattgctaacattattgacatggacgttagttatgggctcaaggtctta
gcctataggtctctcatacgtgtatcttccaatggggaaatagtgatgcactatttgcta
cgacaaatgggtaaagaaatcctccatacagaatcaaagaagactgacaaattagtcgac
aatattcagagttccatgatcgcaacaaaggaaatcgagatcactcgttcaaagagtcgc
cgaaagaacaacaaggaaaagagagtggtttgcgtagtggatcgaggcagccggtccagt
gacctatgggtttggcgaaagtatggtcaaaaacccatcaaaagttctccttatccaagg
agttactatagatgtgccagctcgaaaggttgttttgctaggaaacaagtcgaacgtagc
cgcactgatccaaatgtttcagtaattacttacatctctgagcataaccatccattcccc
actctacgcaatactcttgccggctccactcgttcctcttcctccaaatgctcagatgta
actacttctgcctcatcgacagtctcccaagacaaagaaggaccggataaatcccatttg
ccttcctcccctgcttctcctccttatgcggccatggtggttaaggaggaggacatggag
caatgggacaatatggagttcgatgttgacgttgaagaagatactttcatacccgaatta
tttccagaggataccttcgctgatatggacaagcttgaggaaaattctcagactatgttt
ctctctcgcagaagcagcggaggcaacatggaagcccaagggaagaactctagtgatgat
agggaggtcaatttacctagtaaaattctgaatagatag

DBGET integrated database retrieval system