KEGG   Arabidopsis thaliana (thale cress): AT5G46100Help
Entry
AT5G46100         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR_1 PPR PPR_3 PPR_long ATP13 MRP-S27 DUF4809
Motif
Other DBs
NCBI-GeneID: 834651
NCBI-ProteinID: NP_199422
MIPS: AT5G46100.1
TAIR: AT5G46100
Araport: AT5G46100
UniProt: Q9FNL2
Position
5
AA seq 472 aa AA seqDB search
MGSKVMMFKWSKNITPSQVIKLMRAEKDVEKSMAVFDSATAEYANGYVHDQSSFGYMVLR
LVSANKFKAAEDLIVRMKIENCVVSEDILLSICRGYGRVHRPFDSLRVFHKMKDFDCDPS
QKAYVTVLAILVEENQLNLAFKFYKNMREIGLPPTVASLNVLIKALCRNDGTVDAGLKIF
LEMPKRGCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPTVVTYTSLINGLCGS
KNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTY
TTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAANFLDEMIL
GGITPNRLTWNIHVKTSNEVVRGLCANYPSRAFTLYLSMRSRGISVEVETLESLVKCLCK
KGEFQKAVQLVDEIVTDGCIPSKGTWKLLIGHTLDKTIVGEASDTLLRDLDI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaaagtgatgatgttcaagtggtcaaagaacatcacgccttcacaggttatc
aaactgatgcgagctgaaaaagatgtggagaagtctatggcagtttttgattccgcaacg
gcggaatacgcaaatgggtacgtacatgatcagagttcttttggttatatggtcttgagg
ttggtctctgctaataagttcaaagcagctgaagatctgattgttagaatgaagattgag
aattgtgttgttagtgaagatatattgctttcgatatgtcgagggtatggtcgggttcat
aggccgtttgattctttaagggtttttcacaaaatgaaggattttgattgtgatcctagc
cagaaggcttatgtcactgttcttgccattctcgtggaagagaatcagttaaatttggca
tttaagttttacaagaatatgagagagattggtttgcctcctactgtggcatctctcaat
gttttgattaaagctctttgcagaaatgacggaactgtggatgctggtcttaagattttt
cttgaaatgcctaagagagggtgtgatccggattcttacacatatggaaccttgattagt
ggtttgtgtaggttcggaaggatagatgaggcgaagaagttgtttacagagatggttgag
aaagactgtgcaccaactgttgttacctatacttctctgattaacggtttgtgtggatcg
aaaaatgttgatgaagctatgagatatctagaagagatgaaaagtaaaggcattgagccg
aatgttttcacgtacagttctttgatggacggtctttgcaaagatgggcgttctttgcaa
gccatggaactatttgagatgatgatggctagaggctgcaggccaaacatggtaacgtat
accactttgatcactggtctctgtaaggagcagaagattcaagaagccgttgaacttctt
gatagaatgaatcttcagggtttgaaacctgatgctggattatatgggaaagtaatcagt
gggttctgtgctattagtaagtttcgtgaagctgccaatttccttgacgagatgattctt
ggaggaattactccaaatcgtttaacctggaacatccatgttaagacaagtaatgaagta
gtccgaggtctttgtgcaaactatccaagtcgtgcatttactctatatcttagcatgagg
agtagaggaatctcggttgaggttgaaacactagaatctttggtgaagtgtttgtgcaaa
aagggtgaattccagaaagctgttcaattagtcgatgaaatagtgactgatgggtgtatt
ccaagtaaaggaacatggaagctacttataggtcacacattggataaaacgattgtagga
gaggcttcagatactcttctcagagatttggatatctaa

DBGET integrated database retrieval system