KEGG   Arabidopsis thaliana (thale cress): AT5G46360
Entry
AT5G46360         CDS       T00041                                 

Gene name
KCO3
Definition
(RefSeq) Ca2+ activated outward rectifying K+ channel 3
  KO
K05389  potassium channel subfamily K, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ath04040]
    AT5G46360 (KCO3)
Ion channels [BR:ath04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   AT5G46360 (KCO3)
SSDB
Motif
Pfam: Ion_trans_2 EF-hand_1 EF-hand_7 DUF3624 EF-hand_5 EF-hand_8 DUF3792 Peptidase_A24
Other DBs
NCBI-GeneID: 834679
NCBI-ProteinID: NP_001190480
MIPS: AT5G46360.1
TAIR: AT5G46360
UniProt: Q9XFR0
Position
5
AA seq 260 aa
MPMTPSEFKNRLLFGSLPRSSSDPTDLQFTEPNVPPSLFSLPEHNDDTATDMAPDQETEQ
SVSKSIARQALALLVVYLSLGVLIYWLTLDSDNAYQTHPVAVALYFFVVTFCGFLIVHFV
VKIGWLDSFCFSVMMVTTVGFGDRAFNTWLGTFLAAVWLLVSTLAVARAFLFLADARADK
RNRERAKKVLGESISISQFFAADIDNDGRLSLAEFAIYKLKQMEKITQEDFIQICNHNTH
YNMIEDGSGKSAVLDIVEPV
NT seq 783 nt   +upstreamnt  +downstreamnt
atgccaatgactccatcggaattcaaaaaccgattactcttcggctcattacctcggtca
tcctccgatcccacagacctacaatttacggagcctaacgtaccaccgtctctgttttct
ttaccagaacacaacgacgacacagctactgatatggctcctgaccaggaaacagagcaa
tcagtttcgaaatccattgcaagacaagcacttgctttgcttgttgtgtatctctcttta
ggtgtgcttatctattggctgactctagatagcgacaatgcgtatcagactcatcctgtt
gctgttgctttgtacttttttgttgtaacattttgtggctttttaattgtgcattttgtt
gtgaaaatcgggtggttggattcgttttgtttctcggttatgatggttactacagttggg
tttggtgatcgggcttttaatacatggcttggtacgtttcttgctgcggtttggttgctt
gtttctactttagccgttgctcgagcgtttttgtttttggctgacgcaagagctgataag
agaaatagagagcgggccaagaaagtgcttggcgagagcatatctatatctcagttcttt
gctgcggatattgacaacgatggtcgcttgagtttagcagagtttgcaatatacaaacta
aagcagatggagaaaataacccaagaggactttatacaaatctgtaaccataatacacat
tacaacatgattgaagatggcagtggaaaatccgcggttttggatatagttgaaccagtt
taa

DBGET integrated database retrieval system