KEGG   Arabidopsis thaliana (thale cress): AT5G47400Help
Entry
AT5G47400         CDS       T00041                                 

Definition
(RefSeq) sphingomyelin phosphodiesterase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: mit_SMPDase
Motif
Other DBs
NCBI-GeneID: 834787
NCBI-ProteinID: NP_199551
MIPS: AT5G47400.1
TAIR: AT5G47400
Araport: AT5G47400
UniProt: F4JX48
Position
5
AA seq 862 aa AA seqDB search
MPRGTFAFFFFLVLIFFLLFCPSLVFLFPFTRRDLSRLAFQTLLLRRKPLLYLSIKTLVS
FSPSYLAMLPHSYTVDSLSQSQDLASAILSASTPSSISAACSSVESFLQSHTPDQCRHFF
SVTFPSLICKIFGFGDTTAASPAQSSSLRPNGWIDVISAANDLDLAERVYNLLSPSGILM
SSIFAVDKLALVKYVFPTERLPEYARFMLSSEKDRIALSNLCPFLKGKIEEDSVRGSLCE
VRLNVFEYYMFWLSYYPVCRGNNEISAVNLNPIQKRNKFRLENWTLIKGFPGSNKRDSDQ
KLECNLYIRLLYSYLKAFVPVFDLNAHQPYRSSLLHYGNGYDGSVMTRAEFLVNVFVHYW
LVENDFSPFPVVTAKSFGVAPPFRSAVEEIPPTCGLEEVVKLLVKYLNLSWVTSGVGSEN
YIEYGESPRWKTPTSGSSSHVANLSLRPLTSWNTHLQRPLYRYILRSFLFCPIGSSIKNA
SQVFSIWVTYLEPWMISLDDFSVFEPALSGSVKDMKKEDSYESRVCGYTPLWQSYVISNY
LYYSSLVMHFIGFAHKFLHTDPEIITQMALKVMSTLTSSKELLVLMKNIDKAFHSKQTGP
GNSKVNELSRFSPSIREQLKDWEDGLCESNADGSYLHENWNKDLKLFSDGEDGGQQLLQL
FILRAEAELQTVSDKNLTEALKCVDSLKSAVSNFFGGHVVKPIAFFLEPDHPQKNRDELF
KPRGAGNQTAGGVKYKGDWMTRPVSEDEVALMAKLLINMSIWLNERLGLNKSETSNDKKE
NSESVSYVDVSGEDVGNVAGPGDAAKMLLRGMVMVCGTVLQLMRRFGIRVNLRVMASKKF
LMLLFLYVLFLVVKRVVTRMIW
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtggcacgttcgctttctttttcttcctcgtgttgattttttttcttctcttt
tgtccctctttggtttttcttttccccttcacaaggcgcgatttgagtcgcctcgcattt
caaacccttcttctccggcgtaaacctttgctctatctctcgataaaaacccttgtttcg
ttttcaccttcgtatttagcgatgcttccacactcctacaccgtcgattcgctttcgcaa
tcacaagacctagcttcagctatactctcagcttccacgccgtcgagtatctccgctgct
tgctcttccgtcgaatcgtttcttcagtcgcatacgcctgatcagtgtcgccatttcttc
tctgttacttttccgagtttaatctgtaagatcttcggtttcggcgacacgaccgcggca
tctccggcacagtcttcttcgctgcgaccgaacggttggatcgatgtaatctcggcggcc
aacgatttggatttagcggagagagtatacaatctcttatcccctagtggaatactcatg
agctcaatcttcgctgttgataaattagctcttgttaagtatgttttcccgacggaacgt
ttaccggagtatgctagattcatgctctccagcgagaaggatcgaattgcgttatcgaat
ctgtgcccctttttgaaaggtaaaattgaggaggattcagttcgtggttcattgtgtgaa
gttaggctaaatgtttttgagtattacatgttttggctctcttattatccagtttgtaga
ggaaacaatgagatttcagctgtgaatctgaatcctatccaaaagagaaacaagtttagg
ctagagaattggacacttatcaaaggttttccagggagtaacaagcgtgattctgatcag
aaattggagtgtaatctctacataaggcttctttactcttatttgaaagcatttgttcct
gttttcgacttaaacgctcaccagccttatcgtagttctcttttgcattacggaaatggg
tatgatgggtcagtgatgacaagagctgagttcttggtgaatgttttcgtgcattattgg
cttgttgagaatgacttctcaccatttcctgttgttacggctaaatcttttggtgtggct
cctcctttccgttctgctgtggaggagattccacctacttgtgggttggaagaagtagtg
aagttgcttgtcaagtatctgaatttgagttgggttacaagtggtgttgggagtgaaaac
tacattgagtatggcgagagtccacggtggaagacaccgacttcaggatcgtcatcccat
gtcgcgaatttgagcctcaggccgctcacttcctggaacacccatttacagaggccgctt
tatcgttatatattgaggagtttcttgttctgtcccataggaagctcaattaagaatgca
tctcaggtgttctccatctgggttacgtacctggaaccatggatgatcagtttggatgat
ttctcagtttttgaacctgctttaagtggatctgtaaaagatatgaaaaaggaagattct
tatgaatcacgcgtttgtggatacacgcctttgtggcagagctatgtgatatccaattat
ctctactatagttctctggtcatgcattttattggctttgcacacaagttccttcacaca
gatccagaaataataactcagatggctcttaaggtgatgagtacgttgacatcgtcaaaa
gagcttttggttctgatgaagaatattgataaagcctttcactctaaacaaactggacca
ggaaactcaaaagtgaacgaattgtctagattttctccatctatccgtgagcagttgaag
gattgggaagatgggttgtgtgagagcaacgctgatggctcatacttgcatgaaaactgg
aacaaagacttgaaactctttagtgatggtgaagatggcggacaacaactgcttcagcta
ttcatactgcgggcagaagccgaactgcaaactgtatccgataaaaacctcacagaggcc
cttaagtgtgtagattcactaaaatcagcggtttccaacttctttggcgggcatgtcgta
aaaccaatcgcttttttcctagagccggaccatcctcagaaaaaccgtgacgagctcttc
aagccacgtggtgctggtaaccaaacagcaggcggtgtgaagtacaaaggggactggatg
acccgtccggtgtcagaagacgaggttgcattgatggctaaactgctaatcaacatgtct
atttggctcaatgaacgcctcgggctgaacaaatctgagacgagcaacgacaagaaagag
aattcagagtcagtatcatatgtagatgtatcaggggaagatgtgggaaacgttgcagga
cctggagatgctgcgaagatgctgttgcgagggatggtgatggtatgtggcacagtgttg
cagctgatgagaagattcgggattcgagtcaatcttcgggttatggcttcaaaaaagttt
ctgatgcttttatttctctatgtcctgtttcttgtagtcaaaagggtagtcacaaggatg
atttggtag

DBGET integrated database retrieval system