KEGG   Arabidopsis thaliana (thale cress): AT5G47500Help
Entry
AT5G47500         CDS       T00041                                 

Gene name
PME5
Definition
(RefSeq) Pectin lyase-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 834800
NCBI-ProteinID: NP_199561
MIPS: AT5G47500.1
TAIR: AT5G47500
Araport: AT5G47500
UniProt: Q8LPF3
Position
5
AA seq 362 aa AA seqDB search
MAQLTNSLNYLFSVSLLLFVSFHCLCFRFSLVAACSNSTDDQQIQHHHHRKWVGPSGHKV
ITVSLNGHAQFRSVQDAVDSIPKNNNKSITIKIAPGFYREKVVVPATKPYITFKGAGRDV
TAIEWHDRASDLGANGQQLRTYQTASVTVYANYFTARNISFTNTAPAPLPGMQGWQAVAF
RISGDKAFFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDFIFGNGRSMYKDCELHSIAS
RFGSIAAHGRTCPEEKTGFAFVGCRVTGTGPLYVGRAMGQYSRIVYAYTYFDALVAHGGW
DDWDHKSNKSKTAFFGVYNCYGPGAAATRGVSWARALDYESAHPFIAKSFVNGRHWIAPR
DA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacttactaattccctcaattatctcttttctgtttctctcttattatttgta
tcgttccactgcttatgttttcgtttttcgttggttgcagcttgttcaaactccactgac
gatcaacagattcaacaccatcaccaccggaaatgggttggtccctcaggccacaaagtc
atcaccgtctcacttaacggccacgctcagtttcgctccgtccaagacgctgtggattcc
ataccaaagaacaataacaagagcatcacaatcaagattgctcccggattttacagagag
aaagtggtggttccagctacaaaaccgtacataacgttcaaaggagctggtagggatgtg
accgctatagagtggcacgaccgtgcgtccgaccttggcgctaacggtcaacagttacgt
acctatcaaaccgcttccgtcaccgtctacgctaattatttcaccgctagaaacattagc
ttcacgaatactgcgccggctccattgccggggatgcaagggtggcaagcggtggcgttt
aggatctccggcgacaaagctttcttttccggctgcgggttttacggtgcacaagacact
ttatgcgacgatgctggccgtcattacttcaaggagtgttacattgaaggctctatcgac
tttatctttggtaatggccgctccatgtataaagattgtgagttgcattcgatagcgtca
agattcgggtcgatagcggcgcatggtaggacatgcccggaagagaaaacgggtttcgcg
ttcgtgggttgtcgggtaacaggtacgggtccattgtatgtgggccgggccatgggacaa
tactcacgtatcgtttacgcctacacttactttgatgctctcgtcgctcacggtggttgg
gacgattgggaccacaaatccaacaaaagcaagacggcatttttcggagtgtacaattgc
tatgggccaggagcagcagcgacgagaggcgtgtcttgggctagagctttggactatgaa
tcggcccatccatttatcgctaagagcttcgttaatgggagacattggatcgctcctcga
gatgcttaa

DBGET integrated database retrieval system