KEGG   Arabidopsis thaliana (thale cress): AT5G47810Help
Entry
AT5G47810         CDS       T00041                                 

Gene name
PFK2
Definition
(RefSeq) phosphofructokinase 2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00052  Galactose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
ath03018  RNA degradation
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT5G47810 (PFK2)
   00030 Pentose phosphate pathway
    AT5G47810 (PFK2)
   00051 Fructose and mannose metabolism
    AT5G47810 (PFK2)
   00052 Galactose metabolism
    AT5G47810 (PFK2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AT5G47810 (PFK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT5G47810 (PFK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT5G47810 (PFK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT5G47810 (PFK2)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT5G47810 (PFK2)
Messenger RNA biogenesis [BR:ath03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AT5G47810 (PFK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 834832
NCBI-ProteinID: NP_199592
MIPS: AT5G47810.1
TAIR: AT5G47810
Araport: AT5G47810
UniProt: Q9FIK0
Position
5
AA seq 444 aa AA seqDB search
MAAETSIRKLPSLSGLRHRRNPLEDNPYFHPSNGFYITPSDVILAQVAYDHSAHSQSRVA
YHRAGPRREIMYEPSAVKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRG
FYSMKAVKLDPKAVHDWHKKGGTVLATSRGGFHLQKIVDAIHLNGYNQVYIIGGDGTMRG
AVEIFKEISLRKLEVGITVIPKTVDNDVGIIDRSFGFQTAVEMAQEAISAAHVEAESAVN
GIGLVKLMGRSTGHIALHATLSSRDVDCCLIPEMDFYLEGKGGLFEFLEKRLKERGHAVL
VVAEGAGQEMIPRNESQKQERDESGNAVFLDVGVWFKSVLKAWWEREHPDELFTVKYIDP
TYMIRAVPANATDNLYCTLLAHSAIHGVMAGYTGFVPGPINGNYAYIPLEEVAQTKNQVN
TRDHKWAWVRSVTNQPDFETNVKG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgaaactagcatcaggaagctcccatctctctccggcctccgtcaccgacgt
aatccactggaagataatccctacttccacccctccaatggcttctacatcactccttct
gacgtcatcctcgcccaggtcgcctacgaccactccgcccactcccaatcacgcgtggcc
taccacagggctgggcctcgccgtgagatcatgtacgagccatcagctgtcaaggcggcg
atcgttacgtgcggtgggctgtgccctggcatgaacacagtcataagagaactcgtggtg
ggtctttgggagctgtacggtgtgagagagatatatgggataccagctggttacagaggc
ttttattccatgaaagccgtcaagttagatcccaaggcggttcatgattggcacaagaag
ggtggcactgtcctcgccacttctcgaggtggcttccatctccaaaagatcgtcgatgcc
attcatctcaacggttataaccaggtgtatataataggaggagacggcacaatgcgtggg
gctgttgagatcttcaaggaaatcagcctcaggaaactggaggtgggaatcacggttatt
cccaaaaccgtagacaacgatgtcggcatcattgatagatcatttggctttcaaacggct
gtagagatggctcaggaggctatatctgctgctcacgtggaggccgagagtgcagtcaat
ggcattggacttgtgaagcttatgggcagaagtactggtcacattgctctacatgccact
cttagcagccgtgatgtggactgttgtttgatccctgagatggacttctaccttgaaggc
aaaggtgggctctttgagtttttggagaagagactaaaagaacgtgggcatgctgttctt
gttgtggctgaaggggcaggtcaagagatgatcccaagaaatgaatcacagaaacaagag
agggatgaatctggcaacgcagttttcttggatgtgggagtctggtttaagtccgtgctc
aaggcctggtgggagcgagagcatccagacgagctcttcactgtcaagtatatcgatccg
acttacatgataagagctgtacctgcaaatgctacggataacttgtattgtacactcttg
gcccactcggctatccatggagtcatggctggttacacagggttcgtccctggcccgatc
aatgggaactatgcttatatccccttagaggaggtggcacagactaagaaccaagtaaac
acgcgtgaccacaagtgggcctgggtgcgctcagtcacaaaccagcctgattttgaaacg
aacgttaagggttaa

DBGET integrated database retrieval system