KEGG   Arabidopsis thaliana (thale cress): AT5G48630Help
Entry
AT5G48630         CDS       T00041                                 

Definition
(RefSeq) Cyclin family protein
  KO
K15161  cyclin-C
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G48630
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     AT5G48630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N TFIIB PRP38 LolA_2 DUF5402 Cyclin_C_2
Motif
Other DBs
NCBI-GeneID: 834920
NCBI-ProteinID: NP_199674
MIPS: AT5G48630.1
TAIR: AT5G48630
Araport: AT5G48630
UniProt: Q9FJK7
Position
5
AA seq 253 aa AA seqDB search
MASNFWTSTHYKELKDPEEVNVVHPLDAQRGISVEDFRLIKLHMSNYISKLAQHIKIRQR
VVATAVTYMRRVYTRKSLTEYEPRLVAPTCLYLACKAEESVVHAKLLVFYMKKLYADEKF
RYEIKDILEMEMKVLEALNFYLVVFHPYRSLPEFLQDSGINDTSMTHLTWGLVNDTYRMD
LILIHPPFLITLACIYIASVHKEKDIKTWFEELSVDMNIVKNIAMEILDFYENHRLFTEE
RVHAAFNKLATNP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatttctggacttcgacgcactacaaagagcttaaggacccagaagaggtt
aatgttgttcatcctcttgatgctcagagaggaatctctgttgaagatttcagactcatt
aagcttcatatgtctaattatatatcgaaactggcacaacacattaagattaggcaaaga
gttgttgcaactgcagtaacctatatgcgtcgtgtttacacaagaaagagtttgacggaa
tatgagcctcggcttgttgctcctacatgcttgtatttggcttgcaaagcagaagagagt
gtggtgcatgccaaacttcttgtcttctacatgaaaaaactttatgcggatgaaaagttt
cgatatgagattaaagatattctggaaatggagatgaaggtcttggaagcattgaacttc
tatcttgttgtattccacccatatcgatctctgcctgagttcttgcaggattctggaatc
aatgacactagtatgacccatctaacttggggtcttgtcaacgacacatatagaatggac
ctcatccttatacatccgccgtttctcataacactcgcttgcatttacattgcttctgta
cacaaagagaaagacataaagacatggtttgaagagctttctgtcgacatgaacattgtg
aagaatattgcaatggagatattagatttctatgaaaaccatagactgttcacggaagag
agagttcacgccgccttcaacaaacttgctacaaacccataa

DBGET integrated database retrieval system