KEGG   Arabidopsis thaliana (thale cress): AT5G50920
Entry
AT5G50920         CDS       T00041                                 
Symbol
CLPC1
Name
(RefSeq) CLPC homologue 1
  KO
K03696  ATP-dependent Clp protease ATP-binding subunit ClpC
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT5G50920 (CLPC1)
Chaperones and folding catalysts [BR:ath03110]
 Heat shock proteins
  HSP100
   AT5G50920 (CLPC1)
SSDB
Motif
Pfam: AAA_2 Clp_N AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_22 nSTAND3 TniB UVR AAA_14 AAA_28 NACHT Mg_chelatase AAA_18 Zeta_toxin AAA_25 IstB_IS21 Torsin DNA_pol3_delta2 AAA_23
Other DBs
NCBI-GeneID: 835165
NCBI-ProteinID: NP_568746
TAIR: AT5G50920
UniProt: Q9FI56 A0A178UE63
Structure
Position
5:complement(20715453..20720681)
AA seq 929 aa
MAMATRVLAQSTPPSLACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNNA
LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF
VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRV
LELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNE
VTANVGGGSSSNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCL
IGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME
EIRQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEK
DPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDESLVAAAQLSYQYISDRF
LPDKAIDLIDEAGSRVRLRHAQVPEEARELEKELRQITKEKNEAVRGQDFEKAGTLRDRE
IELRAEVSAIQAKGKEMSKAESETGEEGPMVTESDIQHIVSSWTGIPVEKVSTDESDRLL
KMEETLHKRIIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAA
YYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIE
KAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDE
KDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADILLKEVFERLKKK
EIELQVTERFKERVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVD
AEGNVTVLNGGSGTPTTSLEEQEDSLPVA
NT seq 2790 nt   +upstreamnt  +downstreamnt
atggctatggccacaagggtgttggctcaatcgactccaccgtctttagcttgttaccag
aggaatgttccttcacgtggatctggaagatcgagaagatcggtgaaaatgatgtgtagt
cagttacaagtgtctggtttaagaatgcaagggtttatgggattacgtggtaacaatgct
ttagacactcttggaaaaagtcgtcaagattttcattcgaaggtgcgacaggcaatgaat
gtgcccaaggggaaagctagccggtttacggtgaaagcaatgtttgaaagatttacggag
aaagctatcaaagttattatgcttgctcaggaggaagctagaagactaggccacaatttt
gtgggaaccgaacaaattcttcttggtcttattggtgagggtactggaatcgctgctaaa
gttttgaaatccatggggattaacttaaaagatgcacgtgtggaggttgagaagattatt
ggaaggggaagtggctttgttgctgttgagatcccattcactcctcgtgccaagcgtgtt
cttgaactctctcttgaggaagctcgccaacttggtcacaattacattggatccgagcac
cttttgcttgggttgctacgtgaaggtgaaggagttgcagctcgagtccttgagaattta
ggtgcagatcctagtaatattcgcactcaggtgatacgcatggtgggtgagaacaatgaa
gtaactgctaatgttgggggaggaagcagcagcaataagatgccaactcttgaagagtac
ggaacaaacttgacgaaactggctgaggagggtaaattggacccagttgttggaaggcag
ccgcagatagaacgtgtggtgcaaattcttggcaggagaaccaagaacaacccttgtctt
attggagaacctggtgttggtaagacagctattgctgaaggacttgcacagcgtattgcc
agtggcgatgtccctgaaactattgaagggaagaaggttataacactcgacatgggtctt
ctagttgctggaacaaaatatcgtggagagtttgaagagagattgaaaaagcttatggag
gaaattagacagagcgatgagataatcttatttatcgacgaagtgcatactttgattggg
gctggagcagcagaaggtgcaattgacgcagctaacattttaaaaccagctctcgctaga
ggtgaattgcagtgcattggagcgacaacattagatgaataccgaaagcacattgagaaa
gaccctgccttggaaagaagattccagccagtgaaagtacctgaacctaccgtggatgaa
actattcagatccttaagggtctgcgagagcgatatgaaattcaccacaagcttcgttac
acagacgaatctttagtagcagctgcacagttgtcataccagtatataagtgatcgtttc
cttcctgacaaggcaattgacttgattgatgaagctggttctcgggttcgacttcgtcat
gcacaggtccctgaggaagctagggagcttgagaaggagcttaggcagataacaaaggag
aagaatgaagctgtccgtggccaggactttgagaaggctgggacacttcgggatagagaa
attgaactcagagctgaggtatctgcaatccaagcgaaaggcaaggagatgagcaaagca
gagagtgagaccggtgaggaaggccctatggtcacggagtcagacatccaacacattgtg
tcttcatggactggtattcctgttgagaaagtatcaaccgatgagtctgaccgtctcctc
aagatggaagaaaccctccacaaacgtatcataggccaagacgaagctgtgaaagccata
agccgagccattcgccgtgcacgtgttggactcaagaatcctaaccgtccaatcgctagt
ttcatattctcgggtccaaccggtgttgggaaatctgagcttgccaaagctttagcagct
tactacttcggttccgaagaagccatgattcgtctagatatgagtgagttcatggagagg
cacactgtctccaaactcatcggttcacctcctggatatgtcggatacaccgaaggaggt
cagttaacagaagcggttagacgtcgcccttacaccgtcgttctattcgatgagattgaa
aaagcccatccagatgttttcaacatgatgcttcaaatccttgaagatggtagattaaca
gacagcaaaggaagaacagttgacttcaaaaacacacttctcatcatgacatcaaacgtc
ggaagcagcgtgattgagaaaggaggaagacgtatcggattcgacttagactacgacgag
aaagacagcagttacaacagaatcaagagccttgtaacagaggagctgaaacaatacttc
agacccgagttcctaaacaggctagacgagatgattgtgttcagacagctaacaaagctg
gaagtgaaagaaattgctgacatactgttgaaggaagtgttcgagaggttgaagaagaaa
gagattgagcttcaggtgaccgaaagattcaaagagagagtagtagacgaaggttataac
ccgagctatggagcaagaccgttgagaagagccatcatgaggcttttagaggatagtatg
gcagagaagatgcttgcgagagagatcaaagaaggagactcggtgattgtggacgttgac
gctgaaggtaacgtcacggtgctaaatggtggaagtggcactccaactacttccttggag
gagcaggaagattctctccctgttgcttaa

DBGET integrated database retrieval system