KEGG   Arabidopsis thaliana (thale cress): AT5G51030
Entry
AT5G51030         CDS       T00041                                 

Name
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00590  Arachidonic acid metabolism
ath00790  Folate biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AT5G51030
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT5G51030
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     AT5G51030
    1.1.1.189  prostaglandin-E2 9-reductase
     AT5G51030
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     AT5G51030
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd PDE4_UCR
Other DBs
NCBI-GeneID: 835176
NCBI-ProteinID: NP_199916
TAIR: AT5G51030
UniProt: Q9FI45 A0A654G9U4
Position
5:complement(join(20747862..20748257,20748346..20748540,20748662..20748920,20749258..20749352))
AA seq 314 aa
MVGSKEKSKEKRDKRLQEISLLRTIPYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGH
GLTVILTSRDENVGVEAAKILQEGGFNVDFHRLDILDSSSIQEFCEWIKEKYGFIDVLIN
NAGVNYNVGSDNSVEFSHMVISTNYYGTKNIINAMIPLMRHACQGARIVNVTSRLGRLKG
RHSKLENEDVRAKLMDVDSLTEEIVDKTVSEFLKQVEEGTWESGGWPHSFTDYSVSKMAV
NAYTRVLAKELSERPEGEKIYANCFCPGWVKTAMTGYAGNVSAEDGADTGVWLALLPDQA
ITGKFFAERREISF
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtaggaagcaaagaaaaatcgaaagagaaacgagataagagactccaagagatctcc
ctccttcgtactattccctattctgatcaccagaggtggtggacctctgaaaccgtggcg
gtggtaacaggtgcgaatagaggaataggatttgagatggtgagacaattggctggacat
ggactaacagttattctaacatcaagagacgagaatgtaggcgtcgaagccgccaagatc
cttcaagaaggtggattcaatgttgatttccaccgcctcgatatcttggactcttcctca
atccaagagttttgcgaatggattaaagaaaaatatggatttattgatgttttaattaat
aatgcaggagtaaactacaatgttggatcagataactctgttgaattctcgcatatggtt
atatctaccaactactatggcaccaagaacataatcaacgccatgattccactaatgaga
catgcttgtcaaggagctcgtattgtcaatgtcacttcaaggctcggtagattaaaaggc
cgacacagtaaacttgagaatgaagacgtgagagccaagcttatggatgtggactctcta
actgaagaaatcgttgacaaaacagtatcagagtttttgaaacaagtggaagaaggaaca
tgggaatctggaggttggccacattccttcacagactactctgtctccaaaatggcggtg
aacgcatacacaagagtactagctaaagaactatccgagagaccagagggagagaagata
tatgcaaactgtttttgtcccggttgggtgaaaaccgcaatgacaggctatgcagggaac
gtttcagcagaagatggagctgacactggagtctggcttgcattgcttcctgatcaagct
atcaccggaaagttcttcgccgagagacgtgagatcagtttctaa

DBGET integrated database retrieval system