KEGG   Arabidopsis thaliana (thale cress): AT5G52810
Entry
AT5G52810         CDS       T00041                                 
Name
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: OCD_Mu_crystall Shikimate_DH DUF371 F420_oxidored Sacchrp_dh_NADP GFO_IDH_MocA
Other DBs
NCBI-GeneID: 835358
NCBI-ProteinID: NP_200093
TAIR: AT5G52810
UniProt: Q9FLY0
Position
5:21399331..21400686
AA seq 325 aa
MAALPVFIPAESFPSILSHETLINHFRTNLPKHSSTITSPVRQNYTVSSPSSLLLMPSWS
SSSSLPYMGVKLVTYFPHNSSQNLPGIHGSYTLFSSTTGQTLATMDGTVLTLYRTSSVSG
LGSKILARDDSQVLIMVGSGALAPHLIKSHLAAKPSLRRVIIWNRTPQRAQELAETLSKD
PQHKEISFDSHDSLDQIIPLGDIISCATNSTVPLVKGEFLKPGTHLDLVGSFSHEMKECD
DNAIQRGSVFVDNDTAMIEAGELAGAFERGVIKREDICGNLVELIKGDKEGRKSSTDITV
FKSVGSGTVDLLTAQLVHETYLSRC
NT seq 978 nt   +upstreamnt  +downstreamnt
atggctgcattaccagtattcataccagcagagtcatttccatcgatcctctcacatgaa
accttgatcaatcactttcggaccaatcttccgaaacattcatcaacaatcacaagccct
gtccggcaaaactacaccgtttcatcaccttcctctctcctcctcatgccttcttggtca
tcttcttcttctctcccttacatgggcgtcaagctcgtgacctatttccctcataactct
tctcagaacttacctggcatccatggatcctacacactctttagctccactacaggccaa
accttagctacaatggatggtactgttttaaccctttaccgtacttcctctgtttcaggc
ttaggatccaaaatcctagctagagacgatagtcaagtgctgatcatggttggttccggt
gctctcgcaccacacctgatcaaatcccatctagctgcgaaaccaagcttgagaagagtg
atcatatggaacagaactccacaaagggctcaggagttagctgaaaccctctccaaggat
cctcaacacaaggagatttcattcgatagccacgattcgctagatcaaatcattcctcta
ggagatattataagctgtgcaacaaactcaactgttccattggtcaaaggtgagttcttg
aaacccggaactcatcttgaccttgttggatcgtttagccatgaaatgaaggaatgtgac
gacaatgcgatacagagagggagtgtgtttgtcgataatgacactgcgatgatagaagca
ggagagctcgcgggagcgtttgagagaggagtgattaagagagaagacatttgtgggaat
ttggtggagttgatcaaaggtgacaaagaagggagaaagagttcaacagacataacagtg
tttaagtccgtcggttcgggtaccgtagatctcttaaccgcacaacttgttcacgagact
tacctcagccgttgttaa

DBGET integrated database retrieval system