KEGG   Arabidopsis thaliana (thale cress): AT5G53550Help
Entry
AT5G53550         CDS       T00041                                 

Gene name
YSL3
Definition
(RefSeq) YELLOW STRIPE like 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: OPT
Motif
Other DBs
NCBI-GeneID: 835437
NCBI-ProteinID: NP_001190532
MIPS: AT5G53550.1
TAIR: AT5G53550
Araport: AT5G53550
UniProt: Q2EF88 A0A178U7D6
Position
5
AA seq 675 aa AA seqDB search
MRSMMMEREGRNEIEREVIDDLEETQNEGDDFKSIPPWKEQITFRGIVASLIIGIIYSVI
VMKLNLTTGLVPNLNVSAALLAFVFLRSWTKLLTKAGIVTKPFTKQENTVVQTCAVACYS
IAVGGGFGSYLLGLNRITYEQSGGTHTDGNYPEGTKEPGIGWMTAFLFFTCFVGLLALVP
LRKIMIIDYKLTYPSGTATAVLINGFHTPKGNKMAKKQVFGFVKYFSFSFIWAFFQWFFS
GGTECGFIQFPTFGLEALKNTFYFDFSMTYVGAGMICPHIVNISLLFGAVLSWGIMWPLI
KGLKGDWFPSTLPENSMKSLNGYKVFISISLILGDGLYQFIKILFKTGINMYVKLNNRNS
GKSNSEKDKQSIADLKRDEIFVRDSIPLWVAAVGYAAFSVVSIIAIPIMFPELKWYFIVV
AYMLAPSLGFSNAYGAGLTDMNMAYNYGKVALFILAAMAGKQNGVVAGLVGCGLIKSIVS
ISSDLMHDFKTGHLTLTSPRSMLVSQAIGTAIGCVVAPLTFFLFYKAFDVGNQEGEYKAP
YALVYRNMAILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDRLPDKIGNWVPLPMAMAV
PFLVGGYFAIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILPSSVLALAGV
RPPICMGFMPSKYSS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtatgatgatggagagagagggaaggaatgagatagaaagagaagtaatagat
gacttggaagagacgcaaaacgaaggagatgatttcaagtcaatacctccatggaaggaa
caaatcactttcagaggaattgttgcaagtttaatcattggtataatctacagtgtgatc
gtgatgaaactaaacctaacaacaggtttggtcccaaacctaaatgtctctgcagcactt
ttagcctttgtcttccttagaagctggaccaagctgttgaccaaagccgggattgtgact
aaaccgttcactaaacaagagaacactgttgtccaaacatgtgctgttgcttgttacagc
attgcagttggaggtgggtttggttcataccttcttggtttgaacagaattacttatgaa
cagtcaggaggaactcacactgatgggaattatccggaaggcacgaaagagcctggaatc
ggttggatgaccgctttcttgttctttacttgctttgttggtcttttagcattggttcct
ctaagaaagatcatgatcatagactacaagctgacatatccaagtggaacagctaccgcg
gttttgatcaacggtttccacactcctaaaggcaataaaatggccaagaaacaagtgttt
gggtttgtgaagtacttctcatttagcttcatttgggctttcttccaatggttcttctct
ggtggtacagagtgcggtttcattcagtttccaactttcgggttagaagctttgaagaac
acattctacttcgactttagcatgacatacgttggagcaggaatgatctgtccccatatt
gtcaatatatctttgctttttggcgcggttctgtcttggggaatcatgtggccactcatt
aaaggtcttaaaggagattggttcccatcaactcttcctgaaaacagcatgaagagtctc
aatggttacaaggtgtttatatcaatctcattgatcctcggagacgggctttaccaattc
atcaagatactttttaagacaggaataaacatgtacgtcaagttaaacaatcgcaactct
gggaaatctaattcggagaaagataagcaatctattgcagatcttaaaagagatgagatc
tttgtaagagacagcattccattatgggttgcagcagtaggatacgcagcgttctctgtt
gtctcgatcatcgcgatccctataatgttccccgagctgaaatggtacttcatagtcgta
gcttacatgttagctccatcgttaggtttcagtaacgcttatggagcagggctaacagat
atgaacatggcttataactatggtaaagtcgctctgtttatcttagccgctatggcaggg
aaacaaaatggtgtagtcgcgggacttgtcggatgcgggttgataaaatcgattgtatcg
atttcttctgacctaatgcacgatttcaagacaggacatttgactctgacttcacctagg
tcgatgcttgtgagtcaagcgatcggtacagcgatcggatgcgttgtggcgcctctaact
ttcttcttgttttataaagctttcgatgtcgggaaccaggagggagagtacaaagctcct
tacgctttggtatacagaaacatggcaattcttggagttgaaggtttctctgctttgcct
caacattgtttacagctttgttacgggtttttcgcattcgcggtggcggcaaatctcgtt
agggataggttaccggataagatagggaattgggttccattaccgatggcaatggcggtt
ccgtttcttgttggagggtactttgctattgatatgtgtgtgggaagtttgattgtgttt
gcttggaatatgagagatcgagttaaagccggtttaatggtaccggcggttgcttccggt
ttgatatgtggagatggtctatggattttgccgtcgtcggttcttgctttggccggcgtt
agacctcctatatgtatgggcttcatgccgagtaaatattcgagttaa

DBGET integrated database retrieval system