KEGG   Arabidopsis thaliana (thale cress): AT5G55280Help
Entry
AT5G55280         CDS       T00041                                 

Gene name
FTSZ1-1
Definition
(RefSeq) homolog of bacterial cytokinesis Z-ring protein FTSZ 1-1
  KO
K03531  cell division protein FtsZ
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G55280 (FTSZ1-1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT5G55280 (FTSZ1-1)
   02048 Prokaryotic defense system [BR:ath02048]
    AT5G55280 (FTSZ1-1)
Chromosome and associated proteins [BR:ath03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AT5G55280 (FTSZ1-1)
Cytoskeleton proteins [BR:ath04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   AT5G55280 (FTSZ1-1)
Prokaryotic defense system [BR:ath02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AT5G55280 (FTSZ1-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 835621
NCBI-ProteinID: NP_200339
MIPS: AT5G55280.1
TAIR: AT5G55280
Araport: AT5G55280
UniProt: Q42545 A0A178U8G2
Position
5
AA seq 433 aa AA seqDB search
MAIIPLAQLNELTISSSSSSFLTKSISSHSLHSSCICASSRISQFRGGFSKRRSDSTRSK
SMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAENP
LQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGGTGSGAAPVVA
QISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTP
LQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAE
EAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVV
DDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENKGMSLPHQKQSPST
ISTKSSSPRRLFF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgataattccgttagcacagcttaatgagctaacgatttcttcatcttcttcttcg
tttcttaccaaatcgatatcttctcattcgttgcatagtagctgcatttgcgcaagttct
agaatcagtcaattccgtggcggcttctctaaacgaagaagcgattcaacaaggtctaag
tcgatgcgattgaggtgttccttctctccgatggaatctgcgagaattaaggtgattggt
gtcggtggtggtggtaacaatgccgttaaccggatgatttcaagcggtttacagagtgtt
gatttctatgcgataaacacggattcgcaagctctgttacagtcttctgctgagaaccca
cttcaaattggagaacttttaactcgtgggcttggcactggtggaaacccgcttcttgga
gaacaagctgcagaagaatcaaaagatgcaattgctaatgctcttaaaggatcagacctt
gttttcataactgctggtatgggtggtggaacagggtctggtgctgcacctgtggtagct
cagatttcgaaggatgctggttatttgactgttggtgttgttacctatccgtttagcttt
gaaggacgtaaaagatctttgcaggcactggaagctattgaaaagctccaaaagaatgtt
gatacccttatcgtgattccaaatgatcgtctgctagatattgctgatgaacagacgcca
cttcaggacgcgtttcttcttgcagatgatgttttacgccaaggagtacaaggaatctca
gatattattactatacctggactagtcaatgtagattttgcagatgtgaaggcagtcatg
aaagattctggaactgcaatgctcggggtaggtgtttcttccagcaaaaaccgggcagaa
gaagcagctgaacaagcaactttggctccattgatcggatcatccatacaatcagctact
ggtgtcgtctacaacatcactggtggaaaagacataactttgcaggaagtgaaccgagta
tcacaggtcgtgacaagtttggcagacccatcggccaacatcatatttggagctgttgtg
gatgatcgctacaccggagagattcatgtaacgataatcgccacaggcttctctcagtca
ttccagaagacacttctgactgatccaagagcagctaaactccttgacaaaatgggatca
tcaggtcaacaagagaacaaaggaatgtctctgcctcaccagaagcagtctccatcaact
atctctaccaaatcgtcttctccccgtagacttttcttctag

DBGET integrated database retrieval system