KEGG   Arabidopsis thaliana (thale cress): AT5G56290
Entry
AT5G56290         CDS       T00041                                 
Symbol
PEX5
Name
(RefSeq) peroxin 5
  KO
K13342  peroxin-5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G56290 (PEX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G56290 (PEX5)
Membrane trafficking [BR:ath04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    AT5G56290 (PEX5)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_16 TPR_8 TPR_17 TPR_14 TPR_19 TPR_7 TPR_9 TPR_12 TPR_20 PPTA
Other DBs
NCBI-GeneID: 835728
NCBI-ProteinID: NP_200440
TAIR: AT5G56290
UniProt: Q9FMA3
Position
5:22786496..22792306
AA seq 728 aa
MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPRPQFYS
EDQQIRSLPGSELDQPLLQPGAQGSEFFRGFRSVDQNGLGAAWDEVQQGGPMPPMGPMFE
PVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMARHF
FADRGEEFINSQVNALLSSLDIDDGIQARGHVPGRFRELDDYWNESQAVVKPNLHPADNW
AAEFNQHGMDHGGPDSWVQSFEQQHGVNGWATEFEQGQSQLMSSQMRSMDMQNIAAMEQT
RKLAHTLSQDGNPKFQNSRFLQFVSKMSRGELIIDENQVKQASAPGEWATEYEQQYLGPP
SWADQFANEKLSHGPEQWADEFASGRGQQETAEDQWVNEFSKLNVDDWIDEFAEGPVGDS
SADAWANAYDEFLNEKNAGKQTSGVYVFSDMNPYVGHPEPMKEGQELFRKGLLSEAALAL
EAEVMKNPENAEGWRLLGVTHAENDDDQQAIAAMMRAQEADPTNLEVLLALGVSHTNELE
QATALKYLYGWLRNHPKYGAIAPPELADSLYHADIARLFNEASQLNPEDADVHIVLGVLY
NLSREFDRAITSFQTALQLKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRA
WANMGISYANQGMYKESIPYYVRALAMNPKADNAWQYLRLSLSCASRQDMIEACESRNLD
LLQKEFPL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcgatgagagaccttgttaacggcggagccgcttgtgccgttcctggttcgtcttct
tcttctaatcctctcggagctctcaccaacgctttacttggttcgtcttccaaaacccag
gaaaggctcaaggagatacctaatgcaaaccggtcaggtcctcggccacaattttactct
gaagaccaacagataaggtcacttcctggttctgagttagatcagccacttctgcaaccg
ggtgctcaggggtcagagttcttccgtggttttcgctctgttgatcagaatggtttgggt
gcagcttgggatgaggtacagcaaggtggacctatgcctccaatgggacctatgtttgag
ccagttcagcctacatttgaaggacccccacagagagttttatcaaactttctgcattca
tttgttgagagtagccgtggtggtattccatttcgtccagcacctgttccagttctagga
ttgtcacaaagtgacaaacaatgtatacgtgatcgtagtagcataatggcccggcatttt
tttgccgataggggagaggaatttattaattctcaggtaaacgcattattgtcatcttta
gatattgatgatgggatacaagctcgaggtcatgttcccgggagatttcgggagctagat
gattactggaatgagtctcaagctgttgtgaaacctaatttacatcctgctgacaattgg
gcggctgaatttaaccaacatgggatggatcatggtggtcctgattcatgggtccagtct
tttgagcaacaacatggtgtgaatgggtgggctactgagttcgagcagggtcaatctcaa
ttgatgtcaagccaaatgagaagtatggatatgcaaaatatagctgcaatggagcagact
cgtaagcttgcccatacactatctcaagatgggaatccgaaatttcagaattcaagattc
cttcagtttgtttccaagatgagccgtggtgaacttattattgatgagaatcaggtcaag
caagcttcagcccccggggaatgggctactgaatatgaacagcagtatctggggccacca
agttgggctgatcaatttgcaaatgagaaactttcacatggaccagaacagtgggctgat
gagtttgcttccgggagaggacagcaagaaacagccgaggaccaatgggttaatgagttt
tcaaagttgaatgttgatgactggatagatgaatttgctgaaggtcccgtgggtgatagt
tcagctgatgcatgggcaaatgcttacgatgagtttctgaatgagaaaaatgctggaaaa
caaaccagtggtgtctacgtcttctctgacatgaatccttatgtgggtcaccctgaacct
atgaaagaagggcaagaattgtttcgaaaaggacttctgagtgaagcagcgcttgctcta
gaagctgaggttatgaaaaaccctgagaatgctgaaggttggagattacttggggtcaca
cacgcagagaacgatgatgatcaacaggcaatagctgcaatgatgcgtgcacaggaggct
gatcccacaaatctagaggtgcttcttgcgcttggtgtgagtcataccaacgagttagag
caagcaactgctttgaaatatctatatggatggctgcgaaatcacccaaagtatggagca
attgcgcctccggagctagcggattctttgtaccatgctgatattgctagattattcaat
gaagcttctcagttgaatcctgaggacgccgatgtgcatatagtgttgggcgtgctctac
aatctgtcgagagagttcgatagagcaatcacatccttccaaacagcattacaactaaaa
ccaaacgattattctctgtggaataagctaggtgcaacgcaagccaacagtgtccagagt
gctgatgccatatctgcttatcaacaggctctagatttaaaaccaaattatgttcgtgct
tgggcaaacatgggaatcagttacgcaaaccaggggatgtacaaagaatcaatcccgtat
tatgtccgtgcccttgcgatgaatcctaaagctgataacgcatggcaatacttgagactc
tcgttaagttgtgcatcaaggcaagacatgatagaagcttgtgagtcaaggaatctcgat
ctcttgcagaaagaattcccgctgtga

DBGET integrated database retrieval system