KEGG   Arabidopsis thaliana (thale cress): AT5G56310Help
Entry
AT5G56310         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 PPR_long TPR_14 TPR_19 TPR_17 BTAD DYW_deaminase
Motif
Other DBs
NCBI-GeneID: 835730
NCBI-ProteinID: NP_200442
MIPS: AT5G56310.1
TAIR: AT5G56310
Araport: AT5G56310
UniProt: Q9FMA1 A0A178UI86
Position
5
AA seq 530 aa AA seqDB search
MIQRINALSLSSGLNWFVTSLKIHGNNLKTLKQSHCYMIITGLNRDNLNVAKFIEACSNA
GHLRYAYSVFTHQPCPNTYLHNTMIRALSLLDEPNAHSIAITVYRKLWALCAKPDTFTFP
FVLKIAVRVSDVWFGRQIHGQVVVFGFDSSVHVVTGLIQMYFSCGGLGDARKMFDEMLVK
DVNVWNALLAGYGKVGEMDEARSLLEMMPCWVRNEVSWTCVISGYAKSGRASEAIEVFQR
MLMENVEPDEVTLLAVLSACADLGSLELGERICSYVDHRGMNRAVSLNNAVIDMYAKSGN
ITKALDVFECVNERNVVTWTTIIAGLATHGHGAEALAMFNRMVKAGVRPNDVTFIAILSA
CSHVGWVDLGKRLFNSMRSKYGIHPNIEHYGCMIDLLGRAGKLREADEVIKSMPFKANAA
IWGSLLAASNVHHDLELGERALSELIKLEPNNSGNYMLLANLYSNLGRWDESRMMRNMMK
GIGVKKMAGESSIEVENRVYKFISGDLTHPQVERIHEILQEMDLQIQSKV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgattcagagaatcaatgccttgagcttaagctctggtctaaattggttcgttacctca
ttgaaaatccatggaaataacctcaaaacattaaagcaatctcattgttacatgatcata
accggtttaaacagagacaacctcaacgttgccaaattcatcgaagcatgttcaaatgca
ggacatctccgatatgcttactctgtattcacccaccagccatgtcccaatacttatctc
cacaacaccatgattagagctttgtctctcctcgacgaacccaatgcgcattcgattgcg
atcacggtttatagaaagttatgggctttgtgtgctaagcctgacacgtttactttcccg
tttgtgttgaagattgctgttagggtttctgatgtttggtttgggagacagattcatgga
caagttgtggtttttgggtttgattcgagcgttcatgttgtaacaggtttgattcagatg
tatttttcgtgtggtggtttgggagatgcacgtaagatgttcgatgaaatgcttgtcaag
gatgtgaatgtttggaatgcgttgttagcagggtatgggaaagttggtgagatggatgaa
gctaggagtttgcttgagatgatgccttgttgggtaaggaatgaggtttcttggacttgt
gtgatctctggatatgcgaaaagtggacgagctagcgaagctattgaagtgtttcagaga
atgctgatggagaatgttgagcctgatgaagttacgcttttggctgtgctctcagcttgt
gctgatcttggttcacttgaattgggtgaaagaatatgtagctatgttgatcaccgaggg
atgaacagagcggtttcattgaacaatgcggtcattgatatgtatgcgaaatcagggaat
ataacaaaggcgttggatgtgtttgagtgtgttaatgagagaaatgttgttacttggacg
actataatcgcagggctagctacgcacgggcacggagctgaagccttagcgatgtttaac
cgtatggttaaagctggcgtgagaccgaacgatgttactttcattgcaatcctttcagct
tgcagtcatgtcggttgggttgatcttggaaaacgtttgtttaactcaatgagatcgaaa
tacgggattcatccaaacattgagcattacggatgcatgattgatttgctaggacgagca
ggtaaactccgagaggcggatgaagttattaaaagcatgccctttaaggccaatgctgca
atatggggatctcttcttgctgcttcaaatgttcatcatgatcttgagcttggagaaaga
gctttgagtgagctgattaagttagaaccgaataacagcggtaactatatgcttttagct
aatttatactcgaatttaggaaggtgggatgagtcgaggatgatgaggaacatgatgaaa
gggattggtgtgaagaagatggctggtgaaagctccatagaagttgaaaacagagtatac
aaattcatttcaggggatcttacgcatcctcaagtcgaaaggattcatgaaattctacaa
gagatggatttgcaaatacagagcaaagtttga

DBGET integrated database retrieval system