KEGG   Arabidopsis thaliana (thale cress): AT5G56600Help
Entry
AT5G56600         CDS       T00041                                 

Gene name
PRF3
Definition
(RefSeq) profilin
  KO
K05759  profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Membrane trafficking [BR:ath04131]
 Others
  Actin-binding proteins
   Others
    AT5G56600 (PRF3)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     AT5G56600 (PRF3)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT5G56600 (PRF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 835761
NCBI-ProteinID: NP_200471
MIPS: AT5G56600.1
TAIR: AT5G56600
Araport: AT5G56600
UniProt: Q9FE63
Position
5
AA seq 131 aa AA seqDB search
MSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPGTL
APTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFGIYDEPMTPGQCNMVVE
NLGEYLIESGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacttacgtcgacgatcacttaatgtgcgatgttgcaggcaaccgcctc
accgccgccgcaattctcggccaagacggtagcgtctgggctcagagcaacaattttcct
caggtgaagcctgaggaaattcagggcatcaaagacgattttactacacctggaacactt
gccccaacaggattgttccttggtggtaacaagtacatggtaatccaaggagagcctaat
gccgtcattcgaggaaagaagggagctggtggtgttaccatcaagaagaccaccttagct
ttggtatttggtatctatgatgaaccaatgactcctggacaatgcaatatggttgtggag
aatctcggtgagtacctgattgaatcggggctctga

DBGET integrated database retrieval system