KEGG   Arabidopsis thaliana (thale cress): AT5G56630Help
Entry
AT5G56630         CDS       T00041                                 

Gene name
PFK7
Definition
(RefSeq) phosphofructokinase 7
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00052  Galactose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
ath03018  RNA degradation
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT5G56630 (PFK7)
   00030 Pentose phosphate pathway
    AT5G56630 (PFK7)
   00051 Fructose and mannose metabolism
    AT5G56630 (PFK7)
   00052 Galactose metabolism
    AT5G56630 (PFK7)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AT5G56630 (PFK7)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AT5G56630 (PFK7)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT5G56630 (PFK7)
Messenger RNA biogenesis [BR:ath03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AT5G56630 (PFK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 835764
NCBI-ProteinID: NP_568842
MIPS: AT5G56630.1
TAIR: AT5G56630
Araport: AT5G56630
UniProt: Q9C5J7
Position
5
AA seq 485 aa AA seqDB search
MSSPRSNKPKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSV
PEKVVVHKDGPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYM
YGVKRILGIDGGYRGFYAKNTIPLNSKVVNDIHKRGGTIIGTSRGGHDTNKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESNENGIGFVKLMGRYSGYIAMYATLASRDVDCCLIPESPFYLEGEGGLF
EFIERRLKDHGHMVIVLAEGAGQDLMCKSMESTPMDASGNKLLKDVGLWLSQSIKDHFKK
NKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIP
FYRITETQNNVVITDRMWARLLSSTNQPSFLGPKDTSEEKKELPETPLLDDGAVDIPPVT
KEVTK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccgagaagtaacaagccgaagattgtcaacggtcctggtggttatattcta
caagacgttcctcatctcattgattaccttcctgatcttcctacttatccaaatccattg
caagacaatccagcttactcagtggttaagcaatactttgttcatgctgatgatagtgtc
cctgagaaggttgttgttcacaaggatggtccaagaggagtccatttcaggcgtgctggt
ccacgtcaaaaggtttactttgagtctgacgaagtgcatgcttgtatagttacatgtgga
ggtctctgtcccggtctcaataccgtgattagagaagttgtgagcagcttatcatacatg
tatggagtaaagagaattcttggaatcgatggtggatacagaggattttacgccaagaat
actatccccttaaactctaaagtcgtgaatgatatccataaacgcggaggaacaatcatt
gggacctcaagaggtggacatgataccaacaagatagttgatagcattcaagatcgagga
atcaatcaggtttacattattggaggagatggaacccagcgaggtgcttcagtaatattt
gaggaaattagaagacgtcgactaaaagttgctgtggttggaattccaaaaactattgat
aatgatattccggtgatagataaatcttttgggtttgacactgctgtggaggaagctcaa
cgagcgattaacgcagcacatgttgaagccgagagtaatgagaatggtatcggttttgtc
aagcttatgggtcgttacagcgggtacatagcgatgtatgctacattagccagcagagat
gttgactgttgcttgattcccgagtcaccattttacctcgaaggagaaggtggactcttt
gagttcatagagagacggctgaaggatcatggtcacatggtgattgttcttgctgagggt
gcaggacaggatttgatgtgcaaaagcatggaatctactcctatggatgcttctgggaac
aaacttcttaaagatgtcggcttgtggctatcacaaagcatcaaggatcattttaagaag
aataagatggtgatgaatctcaaatacattgatcctacatacatgatccgggctgttcca
agtaatgcatcagacaatgtttactgtacacttcttgctcagagcgcggttcatggtgca
atggctggttacactggctacaccagtggtcttgtcaatggaagacaaacatacatccct
ttctacaggataacagagacccagaacaatgtagtgattacggatagaatgtgggcgagg
ctattgtcttctacgaaccagccaagtttcttggggcctaaggatacatctgaagagaag
aaagagttgccggaaacaccgcttcttgacgacggagctgtcgatattcctcctgtgact
aaagaggtcactaagtga

DBGET integrated database retrieval system