KEGG   Arabidopsis thaliana (thale cress): AT5G57660Help
Entry
AT5G57660         CDS       T00041                                 

Gene name
COL5
Definition
(RefSeq) CONSTANS-like 5
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: CCT zf-B_box GF_recep_IV
Motif
Other DBs
NCBI-GeneID: 835872
NCBI-ProteinID: NP_568863
MIPS: AT5G57660.1
TAIR: AT5G57660
Araport: AT5G57660
UniProt: Q9FHH8
Position
5
AA seq 355 aa AA seqDB search
MGFGLESIKSISGGWGAAARSCDACKSVTAAVFCRVDSAFLCIACDTRIHSFTRHERVWV
CEVCEQAPAAVTCKADAAALCVSCDADIHSANPLASRHERVPVETFFDSAETAVAKISAS
STFGILGSSTTVDLTAVPVMADDLGLCPWLLPNDFNEPAKIEIGTENMKGSSDFMFSDFD
RLIDFEFPNSFNHHQNNAGGDSLVPVQTKTEPLPLTNNDHCFDIDFCRSKLSAFTYPSQS
VSHSVSTSSIEYGVVPDGNTNNSVNRSTITSSTTGGDHQASSMDREARVLRYREKRKNRK
FEKTIRYASRKAYAESRPRIKGRFAKRTETENDDIFLSHVYASAAHAQYGVVPTF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggattcggcttagagagtatcaaatcaatctccggcggatggggcgcggcggcgcgt
tcctgtgacgcttgtaaatcagttaccgccgccgtgttctgtcgagttgactcagctttc
ttatgcatagcatgtgacacaagaatccattccttcactcgccacgagcgcgtgtgggtt
tgtgaagtttgtgaacaagctcccgccgccgtcacttgcaaagccgacgccgccgctctt
tgcgtcagttgtgatgccgatattcactctgctaatcctctcgctagccgtcacgaacgt
gtccccgtcgaaactttcttcgactcagccgaaaccgccgtcgccaaaatctcagcttct
tcgacttttggtatccttggctcatccaccaccgttgatttaaccgctgttccggttatg
gctgatgatctcggtttatgtccgtggttacttcctaatgatttcaacgaaccggctaaa
atcgaaatcggaactgaaaacatgaaaggttcttctgactttatgttttctgatttcgat
cggcttattgatttcgagtttccgaattcgttcaatcatcatcaaaacaacgccggagga
gatagtcttgttccggttcagacgaaaacagagcctctcccgttaactaacaatgatcat
tgcttcgatattgatttctgcagatcaaagctctctgctttcacttacccttctcaatca
gtcagccacagtgtttcgacttcttctattgaatacggtgtagttcctgacggaaacaca
aacaactctgttaaccggagcacgatcactagctcgacgactggtggtgatcatcaagcg
agctctatggatagagaagctagggttttgaggtacagagagaagagaaagaacaggaaa
tttgagaagacgattcgttacgcttcgaggaaagcttatgcagagtcacggccaaggatc
aaaggccggtttgcgaaaagaacagagacagaaaacgacgacattttccttagtcatgtt
tatgcttcagcagcacacgcacagtacggtgtcgtaccaacgttctga

DBGET integrated database retrieval system