KEGG   Arabidopsis thaliana (thale cress): AT5G57810Help
Entry
AT5G57810         CDS       T00041                                 

Gene name
TET15
Definition
(RefSeq) tetraspanin15
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF2244 TspO_MBR ODV-E18
Motif
Other DBs
NCBI-GeneID: 835890
NCBI-ProteinID: NP_568866
MIPS: AT5G57810.1
TAIR: AT5G57810
Araport: AT5G57810
UniProt: Q1PDI1 A0A178UAN9
Position
5
AA seq 317 aa AA seqDB search
MADNAQVVPVEEPAATATATATATATTEPEAKSSDQMESQSDNKPPMGTLMALVNILAAG
VLPIFTFVLSLTLLGYAVWLLYMRSYDCEDILGLPRVQTLASVGLLAVFVVSNAALFLRR
KFPMPALVVMVVVLLLMLFIGLAYAGVNEMQSRRFPATRMWFKLKIMDDHVTWNNIKSCV
YDKGACNDLIYGSPNEKPYNRRKMPPIKNGCCMPPETCNMDAINATFWYRRKDEGPPSSM
NLMYGDEMMVGRISDCQLWRNDWSILCYDCRSCKFGFIRSVRRKWWQLGIFLIVISILLL
MSHLLIFLATFWERFKG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctgataatgctcaagtagtacccgtcgaggaaccagccgcaaccgccacagccaca
gctacagcaaccgcaacgactgagccagaagccaagagttcagaccaaatggagtcacaa
agtgataataagccaccgatgggaacattgatggcacttgtgaacattttagccgctggt
gtccttccgatcttcactttcgtcctctcacttacactcctcggctacgcagtgtggctt
ctttacatgcgtagctacgactgcgaagatattctcggtctgccacgtgtccagacgcta
gctagtgtcggtcttctcgcggtgtttgttgtcagcaacgcagctctgtttttgcggcgg
aagtttccgatgcctgcacttgtggtgatggtggtggtcttgttgttaatgcttttcatc
ggtttggcgtatgccggagtaaatgagatgcaaagccggcggtttccggcgacaaggatg
tggttcaagctcaaaatcatggacgatcatgtgacctggaacaatatcaaatcgtgtgtc
tatgataaaggagcttgcaacgacctcatttacggatctccaaatgaaaaaccttacaat
agaagaaaaatgccaccaatcaagaatggatgttgtatgccaccagagacatgtaacatg
gacgcgataaacgcgacgttttggtacagaagaaaagacgaaggaccaccgtcgtctatg
aacctaatgtacggtgatgagatgatggtgggaaggattagcgactgtcaactatggagg
aacgattggagcattttatgctatgattgtagatcttgtaagttcggattcataagatcg
gtaaggaggaaatggtggcagctcggtatcttcttgatcgtcatttccattcttcttctc
atgtctcatctcttgatcttcttggctactttttgggaacgattcaagggttag

DBGET integrated database retrieval system