KEGG   Arabidopsis thaliana (thale cress): AT5G58060Help
Entry
AT5G58060         CDS       T00041                                 

Gene name
YKT61
Definition
(RefSeq) SNARE-like superfamily protein
  KO
K08516  synaptobrevin homolog YKT6
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AT5G58060 (YKT61)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G58060 (YKT61)
Membrane trafficking [BR:ath04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    AT5G58060 (YKT61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Longin Peptidase_M61
Motif
Other DBs
NCBI-GeneID: 835918
NCBI-ProteinID: NP_200614
MIPS: AT5G58060.1
TAIR: AT5G58060
Araport: AT5G58060
UniProt: Q9ZRD6 A0A178UM80
Position
5
AA seq 199 aa AA seqDB search
MKITALLVLKCAPEASDPVILSNASDVSHFGYFQRSSVKEFVVFVGRTVASRTPPSQRQS
VQHEEYKVHAYNRNGLCAVGFMDDHYPVRSAFSLLNQVLDEYQKSFGESWRSAKEDSNQP
WPYLTEALNKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSM
ASQMFYKQAKKTNSCCTIL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaccgccttgctcgttctcaagtgcgctcccgaagcttctgatcccgtcatc
ctctccaacgcttcggacgtctctcacttcggttatttccagcgatctagcgtcaaggag
ttcgtcgtctttgtcggtcgcactgtcgctagccgaacccctccttcccaacgccagtct
gttcaacacgaagagtacaaggttcacgcttacaatagaaatggcctttgcgcggtgggt
ttcatggacgatcattaccctgttcgaagtgctttctctcttctcaatcaggtcctagat
gagtaccagaagagttttggtgagtcatggaggtctgcaaaagaagactccaatcagcct
tggccatacttaaccgaagctttaaacaaatttcaggacccagcagaggctgataagctg
ttgaaaatccagagggagttggatgagacaaagattatccttcataaaaccattgatagt
gttctagcccgtggtgagaagctggacagcctagtggagaagagctcagatttgagcatg
gcatcacagatgttttacaagcaagcgaagaaaacaaattcatgctgtactattctgtga

DBGET integrated database retrieval system