KEGG   Arabidopsis thaliana (thale cress): AT5G58700Help
Entry
AT5G58700         CDS       T00041                                 

Gene name
PLC4
Definition
(RefSeq) phosphatidylinositol-speciwc phospholipase C4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
ath04070  Phosphatidylinositol signaling system
ath04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT5G58700 (PLC4)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AT5G58700 (PLC4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AT5G58700 (PLC4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AT5G58700 (PLC4)
Membrane trafficking [BR:ath04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    AT5G58700 (PLC4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    AT5G58700 (PLC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 835984
NCBI-ProteinID: NP_001318832
MIPS: AT5G58700.1
TAIR: AT5G58700
Araport: AT5G58700
UniProt: Q944C1 A0A178UP87
Position
5
AA seq 597 aa AA seqDB search
MEGKKEMGSYKFCLIFTRKFRMTESGPVEDVRDLFEKYTEGDAHMSPEQLQKLMTEEGGE
GETSLEEAERIVDEVLRRKHHIAKFTRRNLTLDDFNYYLFSTDLNPPIADQVHQNMDAPL
SHYFIFTGHNSYLTGNQLSSNCSELPIADALRRGVRVVELDLWPRGTDDVCVKHGRTLTK
EVKLGKCLESIKANAFAISKYPVIITLEDHLTPKLQFKVAKMITQTFGDMLYYHDSQGCQ
EFPSPEELKEKILISTKPPKEYLEANDTKEKDNGEKGKDSDEDVWGKEPEDLISTQSDLD
KVTSSVNDLNQDDEERGSCESDTSCQLQAPEYKRLIAIHAGKPKGGLRMALKVDPNKIRR
LSLSEQLLEKAVASYGADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQ
GYGRALWLMEGMFRANGGCGYVKKPDFLMDASPNGQDFYPKDNSSPKKTLKVKVCMGDGW
LLDFKKTHFDSYSPPDFFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELA
LLRVEVHEHDVNEKDDFGGQTCLPVSEIRQGIRAVPLFNRKGVKYSSTRLLMRFEFV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaaaaaagagatgggtagttacaaattctgtctgatcttcacaaggaagttc
aggatgacggagtctggtcctgtcgaagacgtcagagatcttttcgagaaatacaccgaa
ggcgatgctcatatgtcgccggagcagctacagaagctcatgacggaggaaggaggagaa
ggagaaacaagtctagaggaagcagagagaatcgttgacgaggttcttcgccggaaacat
cacattgcaaagttcaccagacgaaaccttactcttgatgatttcaattattacctcttt
tctactgatcttaatcctcctatcgccgatcaggtccatcaaaacatggatgctccattg
tcacattactttatattcacaggccacaattcctatttaactggaaatcagctaagtagc
aactgcagtgaacttcctattgcagatgcattgagacgaggcgtgagagttgttgagttg
gatctttggccacgtggtaccgatgatgtctgcgttaaacatggaaggacattgacaaag
gaagtgaagttgggaaaatgtttggaatctattaaagctaatgcctttgctatttcaaag
tatcctgttattattactcttgaagaccatctcacgccaaaacttcagtttaaagttgct
aagatgataactcagacatttggagatatgttgtattaccatgattctcaaggttgtcaa
gaatttccttcaccggaagagttgaaggaaaagattctaatttcaacaaaacctccaaaa
gagtacttagaagctaacgatactaaggagaaagataatggagaaaaaggtaaggattcg
gatgaggatgtatggggcaaagagccagaagaccttatttctacgcaatctgatcttgac
aaggtgacaagcagtgtaaatgatctcaatcaagatgatgaagaaagggggtcttgtgag
tctgatacgtcatgccaattacaagcaccagaatacaagcgtcttatcgctatccatgcc
gggaagccaaaaggcggtttacggatggctttaaaggttgatccaaataaaatcaggcga
cttagtctgagtgagcaattacttgagaaagctgtagcatcatatggtgcagatgttatc
agattcactcagaagaattttctgaggatatatcccaaaggcacaaggtttaactcttca
aactataaacctcagatcggttggatgagcggagctcaaatgattgcattcaacatgcag
gggtatggcagagcattgtggctgatggaaggaatgtttcgagcaaatggagggtgcggt
tatgtcaagaagccagattttcttatggatgcaagtcctaatggacaagatttttacccc
aaagataattcgtctccaaagaaaactttaaaggtgaaagtctgtatgggagatggatgg
ctcctagacttcaaaaaaactcactttgattcttattctcctccagatttcttcgttaga
gtgggtattgctggagcacctgttgatgaggtgatggagaaaacaaaaatagagtatgat
acatggacacctatttggaataaggagttcacattccctttagcagttcctgaacttgct
ctgctccgtgttgaagttcatgagcacgacgtgaatgaaaaagatgattttggaggtcaa
acttgtttaccagtttcagagataagacaaggcatacgcgctgttccactctttaatcgc
aagggagtgaaatacagctccacacggcttcttatgcgcttcgagtttgtctga

DBGET integrated database retrieval system