KEGG   Arabidopsis thaliana (thale cress): AT5G59250
Entry
AT5G59250         CDS       T00041                                 
Name
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Sugar_tr MFS_1 MFS_5 TRI12
Other DBs
NCBI-GeneID: 836043
NCBI-ProteinID: NP_200733
TAIR: AT5G59250
UniProt: Q0WWW9 A0A178UN85
Position
5:23903872..23907111
AA seq 558 aa
MAFAVSVQSHFAIRALKRDHFKNPSPRTFCSCFKSRPDSSYLSLKERTCFVSKPGLVTTR
YRHIFQVGAETGGEFADSGEVADSLASDAPESFSWSSVILPFIFPALGGLLFGYDIGATS
GATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRELIIAAV
LYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCPSQIRGTLISLKELFI
VLGILLGFSVGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQL
QEYKEKAMLALSKLRGRPPGDKISEKLVDDAYLSVKTAYEDEKSGGNFLEVFQGPNLKAL
TIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKLLMTWVAVAKVD
DLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQISFGPISWLMVS
EIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGIALVSLLFVILV
VPETKGLSLEEIESKILK
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctttcgctgtctcggttcagtcacatttcgcaatcagagcgttaaaacgagaccac
ttcaagaacccttctcctcgtactttctgctcgtgttttaaatcgaggcctgactcgtct
taccttagtttaaaggaacgtacttgcttcgtttccaaaccgggtttagtcactactaga
tacagacatatattccaggtcggagctgagacgggaggagagttcgccgacagtggagaa
gtagctgattcgcttgcttctgatgcaccagagtcattttcttggtcttctgtgatactc
ccgtttatcttcccggctttgggaggattattgtttgggtatgacattggggctacctcc
ggtgctacgctctcacttcagtcacctgcgcttagcggaactacatggtttaacttctca
cctgttcagctaggacttgtggttagcggatccttgtatggagcccttcttggctcaatt
tctgtctatggcgttgctgatttccttggaagaaggcgggaacttattatagctgctgtt
ctctatctcctcgggtctctgatcactggctgtgcccctgatcttaatattctcttagtt
ggaaggcttctctatggctttggtattggtttggcaatgcatggggctcccctctatatt
gctgagacatgcccatctcaaatccgtggaactttgatatctctgaaagaactcttcatc
gtattgggaattttgttgggtttttctgttggaagcttccagattgatgtagttggaggg
tggcgttacatgtatggatttggtacgcctgttgctttgctgatgggactaggcatgtgg
agtctccctgcatctcctcgctggttgctgcttagagctgtccaaggtaaaggacaatta
caagaatacaaagagaaggccatgcttgccctcagcaaattacgtggcagacctccaggt
gataaaatctcagagaagttggtagatgatgcctatttatctgtgaaaacggcctatgaa
gatgagaaatctgggggaaacttcctggaagtattccaagggcctaatttgaaagctttg
acaattggtggaggtttagtcctcttccaacagataactggacagcctagtgttctttat
tatgcgggttcgattcttcagactgctggattctctgctgctgctgatgcaactcgagtc
tctgttattattggtgttttcaagttactgatgacatgggtagctgttgcgaaagttgat
gatctcggcagacgacctttactgattggaggtgtcagcggcattgcgttgtccttgttt
ctactgtcagcatactacaagtttctcggaggctttccccttgtcgctgttggtgcactg
cttctctatgttggttgttaccagatctcatttggacccatcagctggctaatggtgtca
gagattttcccgctccgcacaagagggagagggatcagtcttgcagttcttacaaacttt
ggctccaatgctattgtgacatttgcattttcacctttaaaggaatttcttggagccgag
aatcttttccttctctttgggggcatagcactggtatcactgctgtttgtaatactagta
gttccagagaccaagggtctcagcttggaagaaattgaatcaaaaatcttgaagtga

DBGET integrated database retrieval system