KEGG   Arabidopsis thaliana (thale cress): AT5G59840Help
Entry
AT5G59840         CDS       T00041                                 

Definition
(RefSeq) Ras-related small GTP-binding family protein
  KO
K07901  Ras-related protein Rab-8A
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AT5G59840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT5G59840
   03036 Chromosome and associated proteins [BR:ath03036]
    AT5G59840
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT5G59840
   04031 GTP-binding proteins [BR:ath04031]
    AT5G59840
Membrane trafficking [BR:ath04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    AT5G59840
 Autophagy
  Other autophagy associated proteins
    AT5G59840
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    AT5G59840
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT5G59840
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G59840
  Exosomal proteins of colorectal cancer cells
   AT5G59840
GTP-binding proteins [BR:ath04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    AT5G59840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase SRPRB AAA_29 PduV-EutP AAA_16 AAA_22
Motif
Other DBs
NCBI-GeneID: 836105
NCBI-ProteinID: NP_200792
MIPS: AT5G59840.1
TAIR: AT5G59840
Araport: AT5G59840
UniProt: Q9FJF1 A0A178UCX7
Position
5
AA seq 216 aa AA seqDB search
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELD
GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDN
VNKILVGNKADMDESKRAVPKSKGQALADEYGIKFFETSAKTNLNVEEVFFSIAKDIKQR
LADTDSRAEPATIKISQTDQAAGAGQATQKSACCGS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccacctgctagagctagagccgattatgattatctcattaagcttcttctc
atcggtgatagcggtgttggtaaaagttgtttgcttctaaggttctctgatggctctttc
accactagcttcatcactaccattggtattgattttaagataagaactattgagcttgat
ggcaaacgtatcaagcttcagatttgggacactgctggtcaagaacgttttcgaaccatc
accactgcttattaccgcggggcaatggggattttactggtgtatgatgtcacagacgag
tcatccttcaacaacattagaaactggattcgtaatattgaacagcacgcttcagataat
gtcaacaaaatcttggtaggaaacaaagctgatatggacgagagcaagagggctgtgcca
aaatcaaagggtcaagcacttgctgacgaatatggaatcaagttctttgaaacaagtgcc
aaaactaatctgaatgtggaagaagttttcttctccatagcaaaggacataaagcagaga
ctcgctgatactgactctagagcagagcctgcaacgatcaagatcagccaaacagaccag
gctgctggagccggacaggccacacagaagtctgcatgctgtggaagttaa

DBGET integrated database retrieval system